BLASTX nr result
ID: Lithospermum22_contig00033743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033743 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004139406.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 96 4e-18 ref|XP_003633155.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 94 9e-18 ref|XP_003549730.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 94 1e-17 ref|XP_003542653.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 93 3e-17 ref|XP_003609454.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 93 3e-17 >ref|XP_004139406.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Cucumis sativus] gi|449518463|ref|XP_004166261.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Cucumis sativus] Length = 602 Score = 95.5 bits (236), Expect = 4e-18 Identities = 43/50 (86%), Positives = 45/50 (90%) Frame = +1 Query: 7 KPQSLVSSDCCIAHKVFSGILRSDVMCTACGFTSTTYDPCVDISLDLEPN 156 KP S + DCCIAH+VFSGILRSDVMC ACGFTSTTYDPCVDISLDLEPN Sbjct: 341 KPYSQGNGDCCIAHRVFSGILRSDVMCMACGFTSTTYDPCVDISLDLEPN 390 >ref|XP_003633155.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Vitis vinifera] Length = 587 Score = 94.4 bits (233), Expect = 9e-18 Identities = 43/52 (82%), Positives = 46/52 (88%) Frame = +1 Query: 1 KGKPQSLVSSDCCIAHKVFSGILRSDVMCTACGFTSTTYDPCVDISLDLEPN 156 K K QS + +CCIAH+VFSGILRSDVMC ACGFTSTTYDPCVDISLDLEPN Sbjct: 324 KRKTQSQGNGECCIAHRVFSGILRSDVMCMACGFTSTTYDPCVDISLDLEPN 375 >ref|XP_003549730.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Glycine max] Length = 592 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/50 (84%), Positives = 44/50 (88%) Frame = +1 Query: 7 KPQSLVSSDCCIAHKVFSGILRSDVMCTACGFTSTTYDPCVDISLDLEPN 156 KP S + DCCIAHKVFSGILRSDV C ACGFTSTTYDPC+DISLDLEPN Sbjct: 331 KPHSEGNGDCCIAHKVFSGILRSDVTCMACGFTSTTYDPCIDISLDLEPN 380 >ref|XP_003542653.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 22-like [Glycine max] Length = 594 Score = 92.8 bits (229), Expect = 3e-17 Identities = 41/50 (82%), Positives = 44/50 (88%) Frame = +1 Query: 7 KPQSLVSSDCCIAHKVFSGILRSDVMCTACGFTSTTYDPCVDISLDLEPN 156 KP + + DCCIAHKVFSGILRSDV C ACGFTSTTYDPC+DISLDLEPN Sbjct: 333 KPHTEGNGDCCIAHKVFSGILRSDVTCMACGFTSTTYDPCIDISLDLEPN 382 >ref|XP_003609454.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355510509|gb|AES91651.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 671 Score = 92.8 bits (229), Expect = 3e-17 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +1 Query: 28 SDCCIAHKVFSGILRSDVMCTACGFTSTTYDPCVDISLDLEPN 156 SDCCIAH+VFSGILRSDVMC ACGFTSTTYDPCVDISLDLEPN Sbjct: 420 SDCCIAHRVFSGILRSDVMCMACGFTSTTYDPCVDISLDLEPN 462