BLASTX nr result
ID: Lithospermum22_contig00033685
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033685 (807 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307479.1| predicted protein [Populus trichocarpa] gi|2... 63 9e-08 ref|XP_002278218.1| PREDICTED: pentatricopeptide repeat-containi... 60 7e-07 ref|XP_003540559.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 >ref|XP_002307479.1| predicted protein [Populus trichocarpa] gi|222856928|gb|EEE94475.1| predicted protein [Populus trichocarpa] Length = 1026 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/62 (46%), Positives = 44/62 (70%) Frame = +3 Query: 3 KEVKKYPGSSWITLGQKTDIFVAGDESHQFSDDLYSLLKYLTTVMKDEDSAVGTELFIED 182 K VKK PG SWI +GQ+T++FVAGD+SH + ++ ++LK LT +M++ D V + F +D Sbjct: 965 KGVKKLPGCSWIVVGQETNMFVAGDKSHHSASEIDAILKDLTPLMRENDYVVQLDFFGDD 1024 Query: 183 CE 188 E Sbjct: 1025 EE 1026 >ref|XP_002278218.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial [Vitis vinifera] gi|302142763|emb|CBI19966.3| unnamed protein product [Vitis vinifera] Length = 1048 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = +3 Query: 3 KEVKKYPGSSWITLGQKTDIFVAGDESHQFSDDLYSLLKYLTTVMKDEDSAVGTELFIED 182 K ++K PG SWI +GQKT++FVAGD+ H + ++++LLK L +MK++ T+ +ED Sbjct: 987 KGLRKLPGCSWIVVGQKTNLFVAGDKFHPSAGEIHALLKDLIALMKEDGYIAETDSLLED 1046 >ref|XP_003540559.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09040, mitochondrial-like [Glycine max] Length = 916 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/49 (48%), Positives = 37/49 (75%) Frame = +3 Query: 3 KEVKKYPGSSWITLGQKTDIFVAGDESHQFSDDLYSLLKYLTTVMKDED 149 K+++K PG SWI +GQ+T++FVAGD SH D++ LK+LT ++KD + Sbjct: 855 KDIQKIPGCSWIVVGQETNLFVAGDISHSSYDEISKALKHLTALIKDNN 903