BLASTX nr result
ID: Lithospermum22_contig00033671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033671 (672 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517182.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002517182.1| conserved hypothetical protein [Ricinus communis] gi|223543817|gb|EEF45345.1| conserved hypothetical protein [Ricinus communis] Length = 244 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/39 (66%), Positives = 33/39 (84%) Frame = +1 Query: 343 KMQDRAKVNAMRSLVVVIGALAFGYLNFHLGFKPFLEKA 459 +M + K+NA+RS +VVIGALAFGYL F +GFKPFLE+A Sbjct: 13 RMNPQTKLNAIRSGIVVIGALAFGYLTFEIGFKPFLERA 51