BLASTX nr result
ID: Lithospermum22_contig00033629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033629 (629 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320208.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 >ref|XP_002320208.1| predicted protein [Populus trichocarpa] gi|222860981|gb|EEE98523.1| predicted protein [Populus trichocarpa] Length = 261 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -3 Query: 627 GAQDTSEKIFLPPLNDLNQVSSTNNEFEQNKGQGGQDNISGYWNGMLGGYSW 472 G Q+ S ++ P +L Q+SST +E +QNKGQGG SGYWNGM GG SW Sbjct: 214 GIQENSGRLLFP-FGELKQLSSTTSEVDQNKGQGGS---SGYWNGMFGGGSW 261