BLASTX nr result
ID: Lithospermum22_contig00033455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033455 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003543493.1| PREDICTED: U-box domain-containing protein 4... 72 4e-11 ref|XP_003554852.1| PREDICTED: U-box domain-containing protein 4... 69 5e-10 emb|CBI34978.3| unnamed protein product [Vitis vinifera] 65 6e-09 ref|XP_002280597.1| PREDICTED: U-box domain-containing protein 4... 65 6e-09 emb|CAN81267.1| hypothetical protein VITISV_006142 [Vitis vinifera] 65 6e-09 >ref|XP_003543493.1| PREDICTED: U-box domain-containing protein 40-like [Glycine max] Length = 557 Score = 72.4 bits (176), Expect = 4e-11 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = -3 Query: 157 PPKEFMCPISRTLMLDPVIVATGHTFERNCVEACKYMSCTPSLPD 23 PP+EF+CPISR+LM DPVIV++GH++ER+ VEACK ++ TP LPD Sbjct: 56 PPEEFLCPISRSLMFDPVIVSSGHSYERSSVEACKNVNFTPQLPD 100 >ref|XP_003554852.1| PREDICTED: U-box domain-containing protein 40-like [Glycine max] Length = 549 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -3 Query: 157 PPKEFMCPISRTLMLDPVIVATGHTFERNCVEACKYMSCTPSLPD 23 PP+EF+CPIS +LM DPVIV++GH+FER+ VEAC ++ TP LPD Sbjct: 56 PPEEFLCPISHSLMFDPVIVSSGHSFERSSVEACINVNFTPQLPD 100 >emb|CBI34978.3| unnamed protein product [Vitis vinifera] Length = 683 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 160 QPPKEFMCPISRTLMLDPVIVATGHTFERNCVEACKYMSCTPSLPD 23 +PPKEF+CPIS +LM DPVIV++G TFER CV+ CK + P+L + Sbjct: 27 EPPKEFLCPISGSLMADPVIVSSGQTFERACVQVCKALGFNPTLSE 72 >ref|XP_002280597.1| PREDICTED: U-box domain-containing protein 40 [Vitis vinifera] Length = 519 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 160 QPPKEFMCPISRTLMLDPVIVATGHTFERNCVEACKYMSCTPSLPD 23 +PPKEF+CPIS +LM DPVIV++G TFER CV+ CK + P+L + Sbjct: 27 EPPKEFLCPISGSLMADPVIVSSGQTFERACVQVCKALGFNPTLSE 72 >emb|CAN81267.1| hypothetical protein VITISV_006142 [Vitis vinifera] Length = 543 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -3 Query: 160 QPPKEFMCPISRTLMLDPVIVATGHTFERNCVEACKYMSCTPSLPD 23 +PPKEF+CPIS +LM DPVIV++G TFER CV+ CK + P+L + Sbjct: 55 EPPKEFLCPISGSLMADPVIVSSGQTFERACVQVCKALGFNPTLSE 100