BLASTX nr result
ID: Lithospermum22_contig00033415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033415 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597941.1| hypothetical protein MTR_2g104240 [Medicago ... 60 1e-07 emb|CBI32912.3| unnamed protein product [Vitis vinifera] 58 7e-07 >ref|XP_003597941.1| hypothetical protein MTR_2g104240 [Medicago truncatula] gi|355486989|gb|AES68192.1| hypothetical protein MTR_2g104240 [Medicago truncatula] Length = 78 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -2 Query: 143 EVQTINQSGAAEAWWAHNPQVPGSKPGSDNYHFSYAHLSTL 21 + + NQSGAAEAWWAHNPQVPGSKPGSD + + LST+ Sbjct: 22 DTKITNQSGAAEAWWAHNPQVPGSKPGSDKF---FLFLSTI 59 >emb|CBI32912.3| unnamed protein product [Vitis vinifera] Length = 42 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +2 Query: 56 YQSQVSILGPVGYGPTTLPLRHSDLLFAL 142 YQSQVSILGPVGYGPTTLPLRHSDLL L Sbjct: 14 YQSQVSILGPVGYGPTTLPLRHSDLLVGL 42