BLASTX nr result
ID: Lithospermum22_contig00033403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033403 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74381.1| hypothetical protein VITISV_007944 [Vitis vinifera] 57 2e-06 >emb|CAN74381.1| hypothetical protein VITISV_007944 [Vitis vinifera] Length = 1884 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -1 Query: 174 CQICGLYNHEALDCNDRFNHAYASTKLNKSLAAMHL-DESTNTI*YPDSGASAHMT-DPQ 1 CQIC NH ALDC +RF++ Y S ++ ++LAAM L +E + Y DSGA+AH+T DP+ Sbjct: 312 CQICSKANHSALDCWNRFDYXYQSEEIPQALAAMALHEEEKDPNFYVDSGATAHITNDPE 371