BLASTX nr result
ID: Lithospermum22_contig00033376
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033376 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270860.2| PREDICTED: tyrosine-sulfated glycopeptide re... 65 6e-09 emb|CAN68301.1| hypothetical protein VITISV_009907 [Vitis vinifera] 64 1e-08 ref|XP_003520891.1| PREDICTED: tyrosine-sulfated glycopeptide re... 61 8e-08 ref|NP_001239911.1| tyrosine-sulfated glycopeptide receptor 1-li... 58 9e-07 ref|XP_003528747.1| PREDICTED: tyrosine-sulfated glycopeptide re... 57 2e-06 >ref|XP_002270860.2| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Vitis vinifera] Length = 1280 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/50 (52%), Positives = 40/50 (80%) Frame = -3 Query: 205 CKNLTVIFMSRTFENEKLPDDYSMGDIDGFQKLEILTLGGGKFTGEVPNW 56 C+NL+ + +++ F NE+LPDD S+ D +GFQ+L++L LGG +FTG+VP W Sbjct: 636 CRNLSTVILTQNFFNERLPDDDSILDSNGFQRLQVLGLGGCRFTGQVPTW 685 >emb|CAN68301.1| hypothetical protein VITISV_009907 [Vitis vinifera] Length = 1188 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = -3 Query: 205 CKNLTVIFMSRTFENEKLPDDYSMGDIDGFQKLEILTLGGGKFTGEVPNW 56 C+NL+ + +++ F NE+LPDD S+ D +GFQ+L++L LGG +FTG +P W Sbjct: 434 CRNLSTVILTQNFFNERLPDDDSILDSNGFQRLQVLGLGGCRFTGSIPGW 483 >ref|XP_003520891.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Glycine max] Length = 1076 Score = 61.2 bits (147), Expect = 8e-08 Identities = 24/49 (48%), Positives = 37/49 (75%) Frame = -3 Query: 202 KNLTVIFMSRTFENEKLPDDYSMGDIDGFQKLEILTLGGGKFTGEVPNW 56 KNL+ + +S+ F NE +PDD ++ + DGFQK+++L LGG FTG++P W Sbjct: 433 KNLSTLMLSQNFFNEMMPDDANITNPDGFQKIQVLALGGCNFTGQIPRW 481 >ref|NP_001239911.1| tyrosine-sulfated glycopeptide receptor 1-like precursor [Glycine max] gi|223452476|gb|ACM89565.1| leucine-rich repeat receptor-like kinase [Glycine max] Length = 1065 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/49 (46%), Positives = 35/49 (71%) Frame = -3 Query: 202 KNLTVIFMSRTFENEKLPDDYSMGDIDGFQKLEILTLGGGKFTGEVPNW 56 KNL+ + +S+ F NE +P D ++ + DGFQKL++L GG FTG++P W Sbjct: 421 KNLSTLMLSKNFFNEMIPQDVNIIEPDGFQKLQVLGFGGCNFTGQIPGW 469 >ref|XP_003528747.1| PREDICTED: tyrosine-sulfated glycopeptide receptor 1-like [Glycine max] Length = 1103 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = -3 Query: 202 KNLTVIFMSRTFENEKLPDDYSMGDIDGFQKLEILTLGGGKFTGEVPNW 56 KNL+ + +S F NE +P D ++ + DGFQKL++L GG FTG++P W Sbjct: 459 KNLSTLMLSMNFFNEMIPQDVNIIEPDGFQKLQVLGFGGCNFTGQIPGW 507