BLASTX nr result
ID: Lithospermum22_contig00033210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033210 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134708.1| PREDICTED: monothiol glutaredoxin-S17-like [... 68 9e-10 ref|XP_002329773.1| glutaredoxin S17 [Populus trichocarpa] gi|22... 67 1e-09 ref|XP_003637390.1| Monothiol glutaredoxin-S17 [Medicago truncat... 67 2e-09 gb|ACJ84480.1| unknown [Medicago truncatula] 67 2e-09 ref|XP_002305803.1| glutaredoxin S17 [Populus trichocarpa] gi|22... 66 3e-09 >ref|XP_004134708.1| PREDICTED: monothiol glutaredoxin-S17-like [Cucumis sativus] gi|449527527|ref|XP_004170762.1| PREDICTED: monothiol glutaredoxin-S17-like [Cucumis sativus] Length = 490 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -2 Query: 440 PTFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 339 PTFPQLYYKG+LIGGCDIVLE++S+GELKATLSE Sbjct: 457 PTFPQLYYKGDLIGGCDIVLELKSNGELKATLSE 490 >ref|XP_002329773.1| glutaredoxin S17 [Populus trichocarpa] gi|222870835|gb|EEF07966.1| glutaredoxin S17 [Populus trichocarpa] Length = 492 Score = 67.0 bits (162), Expect = 1e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -2 Query: 440 PTFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 339 PTFPQLYYKGELIGGCDI+LE+R +GELK+TLSE Sbjct: 459 PTFPQLYYKGELIGGCDIILELRDNGELKSTLSE 492 >ref|XP_003637390.1| Monothiol glutaredoxin-S17 [Medicago truncatula] gi|355503325|gb|AES84528.1| Monothiol glutaredoxin-S17 [Medicago truncatula] Length = 491 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -2 Query: 440 PTFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 339 PTFPQLYYKGELIGGCDI++E+R++GELK+TLSE Sbjct: 458 PTFPQLYYKGELIGGCDIIMELRNNGELKSTLSE 491 >gb|ACJ84480.1| unknown [Medicago truncatula] Length = 491 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -2 Query: 440 PTFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 339 PTFPQLYYKGELIGGCDI++E+R++GELK+TLSE Sbjct: 458 PTFPQLYYKGELIGGCDIIMELRNNGELKSTLSE 491 >ref|XP_002305803.1| glutaredoxin S17 [Populus trichocarpa] gi|222848767|gb|EEE86314.1| glutaredoxin S17 [Populus trichocarpa] Length = 492 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -2 Query: 440 PTFPQLYYKGELIGGCDIVLEMRSSGELKATLSE 339 PTFPQLYYKGELIGGCDI++E+R +GELK+TLSE Sbjct: 459 PTFPQLYYKGELIGGCDIIMELRDNGELKSTLSE 492