BLASTX nr result
ID: Lithospermum22_contig00033055
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00033055 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518058.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002518058.1| conserved hypothetical protein [Ricinus communis] gi|223542654|gb|EEF44191.1| conserved hypothetical protein [Ricinus communis] Length = 2833 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/78 (37%), Positives = 45/78 (57%) Frame = -2 Query: 241 SQKKKMDDRFHVLTDRVKSLSSMISECTGKKIRFGTPSSKGEDDYDEQSDDKRNSDYEDN 62 SQKK +D+RF ++ RV+S + + + GK IRF + SS+GE+ D DD S Sbjct: 430 SQKKDLDERFSAISQRVESFALVHKDFQGKHIRFDSSSSEGEESNDSMHDDTMTS----- 484 Query: 61 NRMHEEQSHYKSTSLNAT 8 + E+SHY ++N+T Sbjct: 485 ---NGERSHYSLQNVNST 499