BLASTX nr result
ID: Lithospermum22_contig00032885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00032885 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518880.1| zinc finger protein, putative [Ricinus commu... 57 2e-06 ref|XP_002262703.1| PREDICTED: dof zinc finger protein DOF4.6-li... 55 5e-06 >ref|XP_002518880.1| zinc finger protein, putative [Ricinus communis] gi|223541867|gb|EEF43413.1| zinc finger protein, putative [Ricinus communis] Length = 306 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/61 (49%), Positives = 40/61 (65%), Gaps = 3/61 (4%) Frame = +2 Query: 8 VVTPHIDLSHHQPNSQNPNM---KFHEGHDLKLGFPSAQDFKTITDLIQVPNFDNPNNKE 178 +VTP I LS Q ++QNPN K EGHDL L FPS Q ++ ++LIQVP+ + NN + Sbjct: 128 LVTPQISLS--QSSTQNPNNNSNKIPEGHDLNLAFPSTQGIRSFSELIQVPSINEGNNNK 185 Query: 179 N 181 N Sbjct: 186 N 186 >ref|XP_002262703.1| PREDICTED: dof zinc finger protein DOF4.6-like [Vitis vinifera] Length = 288 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/47 (48%), Positives = 35/47 (74%) Frame = +2 Query: 41 QPNSQNPNMKFHEGHDLKLGFPSAQDFKTITDLIQVPNFDNPNNKEN 181 Q ++QNP K HEG DL L FP+AQDF+++++ +Q+P+ +N NN N Sbjct: 121 QSSAQNP--KIHEGQDLNLSFPAAQDFRSVSEFMQMPSIENSNNNTN 165