BLASTX nr result
ID: Lithospermum22_contig00032696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00032696 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540629.1| PREDICTED: putative pentatricopeptide repeat... 115 5e-24 ref|XP_003607269.1| UDP-glucoronosyl/UDP-glucosyl transferase fa... 112 2e-23 emb|CBI16176.3| unnamed protein product [Vitis vinifera] 110 2e-22 ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat... 110 2e-22 ref|XP_002532754.1| pentatricopeptide repeat-containing protein,... 108 3e-22 >ref|XP_003540629.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900-like [Glycine max] Length = 903 Score = 115 bits (287), Expect = 5e-24 Identities = 53/90 (58%), Positives = 68/90 (75%) Frame = +3 Query: 3 EVRTLSGLLNGLVRIRQYRVVLELFDEMMGDGIRPDGYVITAVIRSFCELKDFDKAKAMV 182 EVRTLS LLNGL+++R++ V ELFDE + G+RPD Y +AV+RS CELKDF +AK + Sbjct: 189 EVRTLSALLNGLLKVRKFITVWELFDESVNAGVRPDPYTCSAVVRSMCELKDFLRAKEKI 248 Query: 183 SWVERSRLDIGVVMYNVLIHGLCKGARASE 272 W+E + D+ +V YNVLIHGLCKG R SE Sbjct: 249 RWMEANGFDLSIVTYNVLIHGLCKGDRVSE 278 >ref|XP_003607269.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein-like protein [Medicago truncatula] gi|355508324|gb|AES89466.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein-like protein [Medicago truncatula] Length = 970 Score = 112 bits (281), Expect = 2e-23 Identities = 52/90 (57%), Positives = 68/90 (75%) Frame = +3 Query: 3 EVRTLSGLLNGLVRIRQYRVVLELFDEMMGDGIRPDGYVITAVIRSFCELKDFDKAKAMV 182 EVRTLS +LNGL+RIR++ +V E+FDE + G++PD Y +AVIRS CELKDF +AK + Sbjct: 182 EVRTLSAILNGLLRIRKFILVWEVFDESVNAGVKPDPYTCSAVIRSLCELKDFCRAKEKI 241 Query: 183 SWVERSRLDIGVVMYNVLIHGLCKGARASE 272 W+E +R D+ +V YNVLIHGLCKG E Sbjct: 242 LWMESNRFDLSIVTYNVLIHGLCKGGGVLE 271 >emb|CBI16176.3| unnamed protein product [Vitis vinifera] Length = 819 Score = 110 bits (274), Expect = 2e-22 Identities = 51/90 (56%), Positives = 67/90 (74%) Frame = +3 Query: 3 EVRTLSGLLNGLVRIRQYRVVLELFDEMMGDGIRPDGYVITAVIRSFCELKDFDKAKAMV 182 ++RTLSG+LNGL+RIRQ+R+ L LFDE++ G+RPD YV TAV+RS CELKDF +A+ ++ Sbjct: 179 QIRTLSGVLNGLIRIRQFRMALHLFDEIVSSGLRPDVYVYTAVVRSLCELKDFIRAREVI 238 Query: 183 SWVERSRLDIGVVMYNVLIHGLCKGARASE 272 +E S D+ V YNV I GLCK R E Sbjct: 239 GRMESSGCDLSVATYNVFIRGLCKNQRVWE 268 >ref|XP_002281336.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59900 [Vitis vinifera] Length = 900 Score = 110 bits (274), Expect = 2e-22 Identities = 51/90 (56%), Positives = 67/90 (74%) Frame = +3 Query: 3 EVRTLSGLLNGLVRIRQYRVVLELFDEMMGDGIRPDGYVITAVIRSFCELKDFDKAKAMV 182 ++RTLSG+LNGL+RIRQ+R+ L LFDE++ G+RPD YV TAV+RS CELKDF +A+ ++ Sbjct: 179 QIRTLSGVLNGLIRIRQFRMALHLFDEIVSSGLRPDVYVYTAVVRSLCELKDFIRAREVI 238 Query: 183 SWVERSRLDIGVVMYNVLIHGLCKGARASE 272 +E S D+ V YNV I GLCK R E Sbjct: 239 GRMESSGCDLSVATYNVFIRGLCKNQRVWE 268 >ref|XP_002532754.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527505|gb|EEF29631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 721 Score = 108 bits (271), Expect = 3e-22 Identities = 50/90 (55%), Positives = 69/90 (76%) Frame = +3 Query: 3 EVRTLSGLLNGLVRIRQYRVVLELFDEMMGDGIRPDGYVITAVIRSFCELKDFDKAKAMV 182 EVRTLS LLNGL+R R++ VL LFD+++ ++PD Y+ +AV+RS CELKDF+KAK M+ Sbjct: 95 EVRTLSALLNGLLRFRRFNDVLLLFDDIVSANVQPDIYIYSAVVRSLCELKDFNKAKEMI 154 Query: 183 SWVERSRLDIGVVMYNVLIHGLCKGARASE 272 W+E ++ + +V+YNVLIHGLCK R E Sbjct: 155 HWMEFNQCKLSIVVYNVLIHGLCKSRRIWE 184