BLASTX nr result
ID: Lithospermum22_contig00032637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00032637 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149381.1| PREDICTED: uncharacterized protein LOC101208... 62 6e-08 >ref|XP_004149381.1| PREDICTED: uncharacterized protein LOC101208822 [Cucumis sativus] Length = 457 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = -2 Query: 248 KEIMFASPGRAEIVFEGDRKILPSSFISVLEARKLMKKGCAGYLGYVVDLEREE 87 KE++F PG AE+VF G RK++P S ISVL+A KL++KGC + +VV ++REE Sbjct: 350 KEVVFRKPGFAEVVFRGMRKVVPRSLISVLKAEKLLRKGCT-FFAHVVVVQREE 402