BLASTX nr result
ID: Lithospermum22_contig00032594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00032594 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514322.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago ... 54 1e-05 >ref|XP_002514322.1| conserved hypothetical protein [Ricinus communis] gi|223546778|gb|EEF48276.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 9/71 (12%) Frame = -2 Query: 389 EAQRWGNLQASMII---------GTVILQRQGLDEAPGRGGTVSVLKRCICSPTKHPGSF 237 E QRW L+A ++ G +A G GG++ K C+CSPT+HPGSF Sbjct: 16 EEQRWLLLRAVQLVTEQAGTETANAAAASAAGSADAGGGGGSI---KMCVCSPTRHPGSF 72 Query: 236 RCRYHHHSFVW 204 RCR+HH + W Sbjct: 73 RCRHHHVDYAW 83 >ref|XP_002324414.1| predicted protein [Populus trichocarpa] gi|222865848|gb|EEF02979.1| predicted protein [Populus trichocarpa] Length = 85 Score = 56.2 bits (134), Expect = 3e-06 Identities = 20/38 (52%), Positives = 26/38 (68%) Frame = -2 Query: 311 APGRGGTVSVLKRCICSPTKHPGSFRCRYHHHSFVWRG 198 A G +K+C+CSPT+HPGSFRCR+H +VW G Sbjct: 39 ATGSSAVAGSIKKCLCSPTRHPGSFRCRHHRSDYVWGG 76 >ref|XP_002331146.1| predicted protein [Populus trichocarpa] gi|222873229|gb|EEF10360.1| predicted protein [Populus trichocarpa] Length = 88 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/39 (53%), Positives = 28/39 (71%), Gaps = 1/39 (2%) Frame = -2 Query: 311 APGRGGTVS-VLKRCICSPTKHPGSFRCRYHHHSFVWRG 198 A G G +S + +C+CSPT+HPGSFRCR+H +VW G Sbjct: 38 AAGGGSAISRSINKCLCSPTRHPGSFRCRHHRSDYVWSG 76 >ref|XP_003629642.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|357521031|ref|XP_003630804.1| hypothetical protein MTR_8g103600 [Medicago truncatula] gi|355523664|gb|AET04118.1| hypothetical protein MTR_8g083460 [Medicago truncatula] gi|355524826|gb|AET05280.1| hypothetical protein MTR_8g103600 [Medicago truncatula] Length = 83 Score = 54.3 bits (129), Expect = 1e-05 Identities = 20/34 (58%), Positives = 25/34 (73%) Frame = -2 Query: 302 RGGTVSVLKRCICSPTKHPGSFRCRYHHHSFVWR 201 R G +K+C+CSP+KHPGSFRCR H +VWR Sbjct: 45 RAGEDGSIKQCVCSPSKHPGSFRCRQHQAKYVWR 78