BLASTX nr result
ID: Lithospermum22_contig00031901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00031901 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523067.1| ubiquitin-protein ligase, putative [Ricinus ... 85 5e-15 gb|AFK36115.1| unknown [Lotus japonicus] 83 3e-14 ref|XP_002265436.1| PREDICTED: E3 ubiquitin-protein ligase BAH1 ... 82 5e-14 emb|CAN83652.1| hypothetical protein VITISV_015455 [Vitis vinifera] 82 5e-14 ref|XP_002523065.1| ubiquitin-protein ligase, putative [Ricinus ... 81 1e-13 >ref|XP_002523067.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223537629|gb|EEF39252.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 330 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +1 Query: 1 MEELNILLSRRCPEYWGERLQNERIERIQQAKEHWESQCRAFMGV 135 +EELNILLSR CPEYW +RLQ+ER+ERI+QAKEHWE QCRAFMGV Sbjct: 286 LEELNILLSRSCPEYWEQRLQSERVERIRQAKEHWEFQCRAFMGV 330 >gb|AFK36115.1| unknown [Lotus japonicus] Length = 169 Score = 82.8 bits (203), Expect = 3e-14 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 1 MEELNILLSRRCPEYWGERLQNERIERIQQAKEHWESQCRAFMGV 135 +EELNILL RRCPEYW +RL +ER+ER++Q KEHWESQCRAF+GV Sbjct: 125 LEELNILLGRRCPEYWEQRLHSERVERVKQIKEHWESQCRAFLGV 169 >ref|XP_002265436.1| PREDICTED: E3 ubiquitin-protein ligase BAH1 [Vitis vinifera] gi|297743873|emb|CBI36843.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 1 MEELNILLSRRCPEYWGERLQNERIERIQQAKEHWESQCRAFMGV 135 +EELNILLSR C EYW +RLQ ER ERI+QAKEHWESQCRAFMGV Sbjct: 280 LEELNILLSRSCHEYWEQRLQTERTERIRQAKEHWESQCRAFMGV 324 >emb|CAN83652.1| hypothetical protein VITISV_015455 [Vitis vinifera] Length = 239 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = +1 Query: 1 MEELNILLSRRCPEYWGERLQNERIERIQQAKEHWESQCRAFMGV 135 +EELNILLSR C EYW +RLQ ER ERI+QAKEHWESQCRAFMGV Sbjct: 195 LEELNILLSRSCHEYWEQRLQTERTERIRQAKEHWESQCRAFMGV 239 >ref|XP_002523065.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223537627|gb|EEF39250.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 226 Score = 80.9 bits (198), Expect = 1e-13 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 1 MEELNILLSRRCPEYWGERLQNERIERIQQAKEHWESQCRAFMGV 135 +EELN LLSR CPEYW +RLQ+ER+ER++QAKEHWE QCRAF+GV Sbjct: 182 LEELNNLLSRSCPEYWEQRLQSERVERVRQAKEHWELQCRAFLGV 226