BLASTX nr result
ID: Lithospermum22_contig00031596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00031596 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529150.1| amino acid transporter, putative [Ricinus co... 89 3e-16 ref|NP_173924.1| lysine histidine transporter-like 6 [Arabidopsi... 89 5e-16 ref|XP_004172866.1| PREDICTED: lysine histidine transporter-like... 87 1e-15 ref|XP_004135109.1| PREDICTED: lysine histidine transporter-like... 87 1e-15 ref|XP_002890685.1| hypothetical protein ARALYDRAFT_472817 [Arab... 87 1e-15 >ref|XP_002529150.1| amino acid transporter, putative [Ricinus communis] gi|223531429|gb|EEF33263.1| amino acid transporter, putative [Ricinus communis] Length = 418 Score = 89.4 bits (220), Expect = 3e-16 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = +3 Query: 69 LPSVFWLKMKKPKRFSASWLINWTGIIVGAFIMVASTTGGMRNIVADSSTYKFYS 233 LPS+ WL +KKPKRFSA W INW I+VG FIM+AST GG RNIV D+STY+FY+ Sbjct: 364 LPSIMWLIIKKPKRFSAKWFINWASILVGVFIMIASTIGGFRNIVTDASTYRFYT 418 >ref|NP_173924.1| lysine histidine transporter-like 6 [Arabidopsis thaliana] gi|75271987|sp|Q9C6M2.1|LHTL6_ARATH RecName: Full=Lysine histidine transporter-like 6 gi|12321509|gb|AAG50812.1|AC079281_14 lysine and histidine specific transporter, putative [Arabidopsis thaliana] gi|63003796|gb|AAY25427.1| At1g25530 [Arabidopsis thaliana] gi|110741520|dbj|BAE98710.1| hypothetical protein [Arabidopsis thaliana] gi|332192517|gb|AEE30638.1| lysine histidine transporter-like 6 [Arabidopsis thaliana] Length = 440 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/55 (67%), Positives = 46/55 (83%) Frame = +3 Query: 69 LPSVFWLKMKKPKRFSASWLINWTGIIVGAFIMVASTTGGMRNIVADSSTYKFYS 233 LPS+ WL +KKP+RFS +W +NW IIVG FIM+AST GG+RNI+ADSSTY FY+ Sbjct: 386 LPSIMWLIIKKPRRFSVTWFVNWISIIVGVFIMLASTIGGLRNIIADSSTYSFYA 440 >ref|XP_004172866.1| PREDICTED: lysine histidine transporter-like 6-like, partial [Cucumis sativus] Length = 358 Score = 87.0 bits (214), Expect = 1e-15 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +3 Query: 69 LPSVFWLKMKKPKRFSASWLINWTGIIVGAFIMVASTTGGMRNIVADSSTYKFYS 233 LPS+ WL +KKPKR+S +WLINW I VG FIM+AST GG+RNI+ D+STY FY+ Sbjct: 304 LPSIMWLVIKKPKRYSCNWLINWASIFVGVFIMLASTVGGLRNIITDASTYTFYT 358 >ref|XP_004135109.1| PREDICTED: lysine histidine transporter-like 6-like [Cucumis sativus] Length = 437 Score = 87.0 bits (214), Expect = 1e-15 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +3 Query: 69 LPSVFWLKMKKPKRFSASWLINWTGIIVGAFIMVASTTGGMRNIVADSSTYKFYS 233 LPS+ WL +KKPKR+S +WLINW I VG FIM+AST GG+RNI+ D+STY FY+ Sbjct: 383 LPSIMWLVIKKPKRYSCNWLINWASIFVGVFIMLASTVGGLRNIITDASTYTFYT 437 >ref|XP_002890685.1| hypothetical protein ARALYDRAFT_472817 [Arabidopsis lyrata subsp. lyrata] gi|297336527|gb|EFH66944.1| hypothetical protein ARALYDRAFT_472817 [Arabidopsis lyrata subsp. lyrata] Length = 440 Score = 87.0 bits (214), Expect = 1e-15 Identities = 36/55 (65%), Positives = 45/55 (81%) Frame = +3 Query: 69 LPSVFWLKMKKPKRFSASWLINWTGIIVGAFIMVASTTGGMRNIVADSSTYKFYS 233 LPS+ WL +KKP+RFS +W +NW I VG FIM+AST GG+RNI+ADSSTY FY+ Sbjct: 386 LPSIMWLIIKKPRRFSVTWFVNWISIFVGVFIMLASTIGGLRNIIADSSTYSFYA 440