BLASTX nr result
ID: Lithospermum22_contig00031486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00031486 (805 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32242.3| unnamed protein product [Vitis vinifera] 85 2e-14 emb|CAN74679.1| hypothetical protein VITISV_006858 [Vitis vinifera] 85 2e-14 ref|XP_002520661.1| hypothetical protein RCOM_0555330 [Ricinus c... 82 1e-13 ref|XP_002878485.1| zinc ion binding protein [Arabidopsis lyrata... 82 1e-13 ref|XP_002269412.2| PREDICTED: uncharacterized protein LOC100254... 77 3e-12 >emb|CBI32242.3| unnamed protein product [Vitis vinifera] Length = 1398 Score = 85.1 bits (209), Expect = 2e-14 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 2/74 (2%) Frame = -2 Query: 780 YIEFGEGED-STMNPDY-LSSIDEKVEHVLGEFMQDFQGGVSSANLGAKFGGYGSFLPIY 607 Y + G+ +D ++++PD LS IDEK++ VLG F +DF+GGVS+ NLGAKFGGYGSFLP Y Sbjct: 14 YYKDGDDDDGASIDPDVALSYIDEKLQDVLGHFQKDFEGGVSAENLGAKFGGYGSFLPTY 73 Query: 606 TRSLDWSQLRPPSE 565 RS WSQ R P++ Sbjct: 74 QRSPVWSQPRTPAK 87 >emb|CAN74679.1| hypothetical protein VITISV_006858 [Vitis vinifera] Length = 1671 Score = 85.1 bits (209), Expect = 2e-14 Identities = 43/74 (58%), Positives = 57/74 (77%), Gaps = 2/74 (2%) Frame = -2 Query: 780 YIEFGEGED-STMNPDY-LSSIDEKVEHVLGEFMQDFQGGVSSANLGAKFGGYGSFLPIY 607 Y + G+ +D ++++PD LS IDEK++ VLG F +DF+GGVS+ NLGAKFGGYGSFLP Y Sbjct: 14 YYKDGDDDDGASIDPDVALSYIDEKLQDVLGHFQKDFEGGVSAENLGAKFGGYGSFLPTY 73 Query: 606 TRSLDWSQLRPPSE 565 RS WSQ R P++ Sbjct: 74 QRSPVWSQPRTPAK 87 >ref|XP_002520661.1| hypothetical protein RCOM_0555330 [Ricinus communis] gi|223540046|gb|EEF41623.1| hypothetical protein RCOM_0555330 [Ricinus communis] Length = 1670 Score = 82.4 bits (202), Expect = 1e-13 Identities = 40/71 (56%), Positives = 53/71 (74%), Gaps = 1/71 (1%) Frame = -2 Query: 765 EGEDSTMNPDY-LSSIDEKVEHVLGEFMQDFQGGVSSANLGAKFGGYGSFLPIYTRSLDW 589 +G D++++PD LS ID K++ VLG F +DF+GGVS+ NLGAKFGGYGSFLP Y RS W Sbjct: 21 DGYDASIDPDIALSYIDVKLQDVLGHFQKDFEGGVSAENLGAKFGGYGSFLPTYQRSPVW 80 Query: 588 SQLRPPSEDSD 556 S R P ++ + Sbjct: 81 SHPRTPPKNQN 91 >ref|XP_002878485.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297324323|gb|EFH54744.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] Length = 1387 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/70 (54%), Positives = 51/70 (72%), Gaps = 1/70 (1%) Frame = -2 Query: 750 TMNPDY-LSSIDEKVEHVLGEFMQDFQGGVSSANLGAKFGGYGSFLPIYTRSLDWSQLRP 574 +++PD LS IDEK++H+LG F +DF+GGVS+ NLGAK+GGYGSFLP Y RS WS + Sbjct: 23 SIDPDNDLSYIDEKLQHILGHFQKDFEGGVSAENLGAKYGGYGSFLPTYQRSPVWSHPKT 82 Query: 573 PSEDSDDAST 544 P++ T Sbjct: 83 PAKPQSSTGT 92 >ref|XP_002269412.2| PREDICTED: uncharacterized protein LOC100254466 [Vitis vinifera] Length = 1730 Score = 77.4 bits (189), Expect = 3e-12 Identities = 41/84 (48%), Positives = 55/84 (65%), Gaps = 12/84 (14%) Frame = -2 Query: 780 YIEFGEGED-STMNPDYLSSI-----------DEKVEHVLGEFMQDFQGGVSSANLGAKF 637 Y + G+ +D ++++PD S DEK++ VLG F +DF+GGVS+ NLGAKF Sbjct: 14 YYKDGDDDDGASIDPDVALSYIVRVSIAQSLKDEKLQDVLGHFQKDFEGGVSAENLGAKF 73 Query: 636 GGYGSFLPIYTRSLDWSQLRPPSE 565 GGYGSFLP Y RS WSQ R P++ Sbjct: 74 GGYGSFLPTYQRSPVWSQPRTPAK 97