BLASTX nr result
ID: Lithospermum22_contig00031302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00031302 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_16599980.1| hypothetical protein HMPREF9565_01484, partia... 98 8e-19 ref|ZP_05839395.1| conserved hypothetical protein [Brucella suis... 86 2e-15 ref|ZP_04663903.1| conserved hypothetical protein [Bifidobacteri... 81 8e-14 emb|CAJ30042.1| hypothetical protein mgI382 [Magnetospirillum gr... 76 3e-12 ref|ZP_16599981.1| hypothetical protein HMPREF9565_01483 [Propio... 74 2e-11 >ref|ZP_16599980.1| hypothetical protein HMPREF9565_01484, partial [Propionibacterium acnes HL053PA2] gi|315078258|gb|EFT50297.1| hypothetical protein HMPREF9565_01484 [Propionibacterium acnes HL053PA2] Length = 48 Score = 97.8 bits (242), Expect = 8e-19 Identities = 46/46 (100%), Positives = 46/46 (100%) Frame = -1 Query: 139 MEFLVERWNAQISGGTPVAKAVLWAFPDAEERKRGERTGLDTLVVH 2 MEFLVERWNAQISGGTPVAKAVLWAFPDAEERKRGERTGLDTLVVH Sbjct: 1 MEFLVERWNAQISGGTPVAKAVLWAFPDAEERKRGERTGLDTLVVH 46 >ref|ZP_05839395.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|261219753|ref|ZP_05934034.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261313973|ref|ZP_05953170.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] gi|261316150|ref|ZP_05955347.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|260154114|gb|EEW89197.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] gi|260924842|gb|EEX91410.1| conserved hypothetical protein [Brucella ceti M13/05/1] gi|261295373|gb|EEX98869.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] gi|261302999|gb|EEY06496.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 62 Score = 86.3 bits (212), Expect = 2e-15 Identities = 43/58 (74%), Positives = 45/58 (77%) Frame = +2 Query: 32 LPTLSLLSVRKGPENRLRHWCSS*YLRIPPLHQEFHSPLPSSSQPVSKARSGLSPKIT 205 LPTLS LSV GP +RLRHWCSS YLRI PLH EFHSPLP S PVSKA GLSP I+ Sbjct: 2 LPTLSHLSVSNGPVSRLRHWCSSEYLRISPLHSEFHSPLPYSRLPVSKAVPGLSPGIS 59 >ref|ZP_04663903.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis CCUG 52486] gi|239516221|gb|EEQ56088.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 94 Score = 81.3 bits (199), Expect = 8e-14 Identities = 41/56 (73%), Positives = 41/56 (73%) Frame = +3 Query: 3 WTTRVSKPVRSPRFRSSASGKAQRTAFATGVPPDICAFHRSTRNSILPYLPQVNPY 170 WTTRVS PVRSPRFRSSAS AQR AFA GV PDI FHR T NS LPY Q PY Sbjct: 33 WTTRVSNPVRSPRFRSSASVTAQRPAFAIGVLPDIYTFHRYTGNSSLPYRTQARPY 88 >emb|CAJ30042.1| hypothetical protein mgI382 [Magnetospirillum gryphiswaldense MSR-1] Length = 78 Score = 75.9 bits (185), Expect = 3e-12 Identities = 38/59 (64%), Positives = 43/59 (72%) Frame = +2 Query: 32 LPTLSLLSVRKGPENRLRHWCSS*YLRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITL 208 LPTLS +SV + P +RLRHWCSS YLRI PLH EFH PL SS VSKA LSP ++L Sbjct: 2 LPTLSHMSVNRRPGSRLRHWCSSEYLRISPLHSEFHYPLRDSSSTVSKAVPRLSPGLSL 60 >ref|ZP_16599981.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] gi|315078257|gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes HL053PA2] Length = 113 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +2 Query: 107 LRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLP 211 +RIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLP Sbjct: 1 MRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLP 35