BLASTX nr result
ID: Lithospermum22_contig00031063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00031063 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containi... 65 6e-09 ref|XP_002520999.1| pentatricopeptide repeat-containing protein,... 60 2e-07 ref|XP_004146997.1| PREDICTED: putative pentatricopeptide repeat... 60 2e-07 ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 >ref|XP_002275680.2| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Vitis vinifera] gi|297735515|emb|CBI17955.3| unnamed protein product [Vitis vinifera] Length = 627 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/60 (53%), Positives = 39/60 (65%) Frame = +2 Query: 131 EKFLKINCKYGTIKINDALNHFQQMLHMLPAPETSSFNLLLGGVAKIKNYEQVVFLYNKM 310 E FLK NCK G IK ++A + F ++ M P P SSFN LLG VAKIK Y V+ LY +M Sbjct: 59 ENFLKSNCKSGHIKRSEAFSVFNHLIDMQPTPPISSFNTLLGAVAKIKRYFDVISLYKRM 118 >ref|XP_002520999.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539836|gb|EEF41416.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 628 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/66 (43%), Positives = 41/66 (62%) Frame = +2 Query: 131 EKFLKINCKYGTIKINDALNHFQQMLHMLPAPETSSFNLLLGGVAKIKNYEQVVFLYNKM 310 E+FL+INCK G +++AL+ F QM+HM P S FN L G +AK K Y V+ + +M Sbjct: 74 EQFLEINCKSGDFTLHEALHFFNQMIHMQTTPALSRFNNLFGALAKKKQYLHVISMCGRM 133 Query: 311 VAASLL 328 + LL Sbjct: 134 NSIGLL 139 >ref|XP_004146997.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Cucumis sativus] Length = 481 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/59 (50%), Positives = 36/59 (61%) Frame = +2 Query: 149 NCKYGTIKINDALNHFQQMLHMLPAPETSSFNLLLGGVAKIKNYEQVVFLYNKMVAASL 325 NCK G I + A + F M+ P P SSFN LLGG+AKI +Y Q+ LYNKM A L Sbjct: 63 NCKTGNIDVIQAFHFFDLMMRSHPIPPISSFNRLLGGLAKINHYSQLFSLYNKMRLAGL 121 >ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 605 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/63 (46%), Positives = 37/63 (58%) Frame = +2 Query: 137 FLKINCKYGTIKINDALNHFQQMLHMLPAPETSSFNLLLGGVAKIKNYEQVVFLYNKMVA 316 F +CK G + AL+ F M+ P P SSFN LL G+AKIK+Y QV LYN+M Sbjct: 38 FFLRHCKTGNVTATHALHFFHLMMRSTPTPSLSSFNHLLSGLAKIKHYSQVFSLYNQMRL 97 Query: 317 ASL 325 + L Sbjct: 98 SGL 100 >ref|XP_004148968.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 580 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/63 (46%), Positives = 37/63 (58%) Frame = +2 Query: 137 FLKINCKYGTIKINDALNHFQQMLHMLPAPETSSFNLLLGGVAKIKNYEQVVFLYNKMVA 316 F +CK G + AL+ F M+ P P SSFN LL G+AKIK+Y QV LYN+M Sbjct: 38 FFLRHCKTGNVTATHALHFFHLMMRSTPTPSLSSFNHLLSGLAKIKHYSQVFSLYNQMRL 97 Query: 317 ASL 325 + L Sbjct: 98 SGL 100