BLASTX nr result
ID: Lithospermum22_contig00030614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030614 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450843.1| hypothetical protein SORBIDRAFT_05g019526 [S... 42 2e-06 >ref|XP_002450843.1| hypothetical protein SORBIDRAFT_05g019526 [Sorghum bicolor] gi|241936686|gb|EES09831.1| hypothetical protein SORBIDRAFT_05g019526 [Sorghum bicolor] Length = 1209 Score = 41.6 bits (96), Expect(2) = 2e-06 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = -1 Query: 290 GTIPSYTWRSLLFVRDMLSKGIM*QIGNGREINIWGQRWL 171 G PS WRS+L RD+L +G++ +IG G IW WL Sbjct: 944 GNAPSRIWRSILDGRDVLEQGLIRRIGTGEATYIWTMNWL 983 Score = 35.0 bits (79), Expect(2) = 2e-06 Identities = 17/57 (29%), Positives = 28/57 (49%) Frame = -3 Query: 183 AEMAKAQSELIDGDMGVWDISKIKAFCFDIDQQFILDLSLPNLHRPDIPKWFNDPRG 13 A + + SELID WD+ K+ F +D++ I+++ L + D W D G Sbjct: 997 ANLPQKVSELIDSTTMSWDMQKLHEFFAPMDRETIVNIPLSTRRQSDFWAWHYDKNG 1053