BLASTX nr result
ID: Lithospermum22_contig00030595
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030595 (816 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552777.1| PREDICTED: uncharacterized protein LOC100790... 56 8e-06 ref|XP_003537528.1| PREDICTED: uncharacterized protein LOC100785... 56 8e-06 ref|XP_003601730.1| Kinesin-like protein KIF15 [Medicago truncat... 56 8e-06 emb|CBI17294.3| unnamed protein product [Vitis vinifera] 56 8e-06 ref|XP_002265361.1| PREDICTED: uncharacterized protein LOC100264... 56 8e-06 >ref|XP_003552777.1| PREDICTED: uncharacterized protein LOC100790375 [Glycine max] Length = 1245 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 816 LSQLGNLINILAEVSQTGKQRHIPYRVSSL 727 LSQLGNLINILAEVSQTGKQRHIPYR S L Sbjct: 358 LSQLGNLINILAEVSQTGKQRHIPYRDSRL 387 >ref|XP_003537528.1| PREDICTED: uncharacterized protein LOC100785790 [Glycine max] Length = 1246 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 816 LSQLGNLINILAEVSQTGKQRHIPYRVSSL 727 LSQLGNLINILAEVSQTGKQRHIPYR S L Sbjct: 358 LSQLGNLINILAEVSQTGKQRHIPYRDSRL 387 >ref|XP_003601730.1| Kinesin-like protein KIF15 [Medicago truncatula] gi|355490778|gb|AES71981.1| Kinesin-like protein KIF15 [Medicago truncatula] Length = 1271 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 816 LSQLGNLINILAEVSQTGKQRHIPYRVSSL 727 LSQLGNLINILAEVSQTGKQRHIPYR S L Sbjct: 383 LSQLGNLINILAEVSQTGKQRHIPYRDSRL 412 >emb|CBI17294.3| unnamed protein product [Vitis vinifera] Length = 1251 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 816 LSQLGNLINILAEVSQTGKQRHIPYRVSSL 727 LSQLGNLINILAEVSQTGKQRHIPYR S L Sbjct: 376 LSQLGNLINILAEVSQTGKQRHIPYRDSRL 405 >ref|XP_002265361.1| PREDICTED: uncharacterized protein LOC100264192 [Vitis vinifera] Length = 1354 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -1 Query: 816 LSQLGNLINILAEVSQTGKQRHIPYRVSSL 727 LSQLGNLINILAEVSQTGKQRHIPYR S L Sbjct: 376 LSQLGNLINILAEVSQTGKQRHIPYRDSRL 405