BLASTX nr result
ID: Lithospermum22_contig00030546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030546 (777 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACB28472.1| polyprotein [Ananas comosus] 58 2e-06 gb|AAL76001.1|AF466646_9 putative gag-pol polyprotein [Zea mays] 57 4e-06 >gb|ACB28472.1| polyprotein [Ananas comosus] Length = 953 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 107 IVVVDTLTKYSHFISLSHPFTASKVARAFLDNVYK 3 +VVVD L+KY+HFI+LSHP+TAS VA+ FLDN+YK Sbjct: 798 MVVVDRLSKYAHFIALSHPYTASSVAQLFLDNIYK 832 >gb|AAL76001.1|AF466646_9 putative gag-pol polyprotein [Zea mays] Length = 2396 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -2 Query: 107 IVVVDTLTKYSHFISLSHPFTASKVARAFLDNVYK 3 +VVVD +KY HF+ L HPFTA+KVAR FLDNVYK Sbjct: 1215 LVVVDKFSKYGHFLPLLHPFTAAKVARVFLDNVYK 1249