BLASTX nr result
ID: Lithospermum22_contig00030362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030362 (548 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 58 1e-06 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = +2 Query: 293 SVLMRVKKVGSWQKCSRYIQEQRTRIYIIWRCSIILLSSDD 415 S +R K SWQ+CSR ++EQRTR+YIIWRC++ILLS DD Sbjct: 6 SAWIRFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/45 (53%), Positives = 35/45 (77%) Frame = +2 Query: 281 MGSHSVLMRVKKVGSWQKCSRYIQEQRTRIYIIWRCSIILLSSDD 415 M + ++ MR K+ SWQ+CS+ I+EQRTR+YIIWRC+++LL D Sbjct: 20 MAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64