BLASTX nr result
ID: Lithospermum22_contig00030361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030361 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002516785.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002320393.1| predicted protein [Populus trichocarpa] gi|222861166|gb|EEE98708.1| predicted protein [Populus trichocarpa] Length = 64 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/44 (52%), Positives = 35/44 (79%) Frame = -2 Query: 384 KVIMERHSVMMRVKKIGSWQKCSRYIQEQRTRIYIIWKCSMILL 253 K+ M ++ MR K+ SWQ+CS+ I+EQRTR+YIIW+C+++LL Sbjct: 17 KIQMAADALSMRSMKLRSWQRCSKQIREQRTRLYIIWRCTVMLL 60 >ref|XP_002516785.1| conserved hypothetical protein [Ricinus communis] gi|223543873|gb|EEF45399.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 55.8 bits (133), Expect = 4e-06 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = -2 Query: 369 RHSVMMRVKKIGSWQKCSRYIQEQRTRIYIIWKCSMILLKSEE 241 + S +R K SWQ+CSR ++EQRTR+YIIW+C++ILL ++ Sbjct: 4 QRSAWIRFPKFRSWQRCSRLVKEQRTRLYIIWRCTVILLSWDD 46