BLASTX nr result
ID: Lithospermum22_contig00030356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030356 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531919.1| RNA and export factor binding protein, putat... 58 9e-07 gb|AFW62220.1| hypothetical protein ZEAMMB73_911092 [Zea mays] 55 4e-06 gb|AAT08172.1| Hin19 [Nicotiana tabacum] 55 4e-06 ref|NP_001078676.1| THO complex subunit 4 [Arabidopsis thaliana]... 55 6e-06 ref|NP_198588.2| THO complex subunit 4 [Arabidopsis thaliana] gi... 55 6e-06 >ref|XP_002531919.1| RNA and export factor binding protein, putative [Ricinus communis] gi|223528429|gb|EEF30463.1| RNA and export factor binding protein, putative [Ricinus communis] Length = 268 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = +1 Query: 196 KNSPWQNNVLGDRFKAMESSGVESGTKLQLSNLSDEVSNEDIRELFSE 339 +N PWQ+++L D +A +GVE GTKL +SNL VSNEDIRELF+E Sbjct: 70 RNLPWQHDLLEDSIRAAGITGVEVGTKLYVSNLEYGVSNEDIRELFAE 117 >gb|AFW62220.1| hypothetical protein ZEAMMB73_911092 [Zea mays] Length = 226 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = +1 Query: 172 LYQTMCSTKNSPWQNNVLGDRFKAMESSGVESGTKLQLSNLSDEVSNEDIRELFSE 339 ++Q+ TK+ W+ ++ D +M +SG+E+GTKL +SNL VSNEDI+ELFSE Sbjct: 4 IFQSFSRTKDMTWRPDLFSD---SMAASGIETGTKLYISNLDYGVSNEDIKELFSE 56 >gb|AAT08172.1| Hin19 [Nicotiana tabacum] Length = 219 Score = 55.5 bits (132), Expect = 4e-06 Identities = 32/62 (51%), Positives = 39/62 (62%), Gaps = 3/62 (4%) Frame = +1 Query: 163 WVYLYQTMCSTKNSPWQNN--VLGDRFKAME-SSGVESGTKLQLSNLSDEVSNEDIRELF 333 W Q+ TKN PWQN + D +A SSG+ESGTK+ +SNL V+N DIRELF Sbjct: 1 WACSLQSSRRTKNLPWQNGNGLFEDSLRAAGISSGLESGTKVYVSNLDVGVTNSDIRELF 60 Query: 334 SE 339 SE Sbjct: 61 SE 62 >ref|NP_001078676.1| THO complex subunit 4 [Arabidopsis thaliana] gi|332006840|gb|AED94223.1| THO complex subunit 4 [Arabidopsis thaliana] Length = 280 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +1 Query: 196 KNSPWQNNVLGDRFKAMESSGVESGTKLQLSNLSDEVSNEDIRELFSE 339 ++ PWQ+ + D +A +SGVE GT+L ++NL V+NEDIRELFSE Sbjct: 68 RSLPWQSGLFEDGLRAAGASGVEVGTRLHVTNLDQGVTNEDIRELFSE 115 >ref|NP_198588.2| THO complex subunit 4 [Arabidopsis thaliana] gi|37201990|gb|AAQ89610.1| At5g37720 [Arabidopsis thaliana] gi|110735849|dbj|BAE99901.1| hypothetical protein [Arabidopsis thaliana] gi|332006839|gb|AED94222.1| THO complex subunit 4 [Arabidopsis thaliana] Length = 288 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +1 Query: 196 KNSPWQNNVLGDRFKAMESSGVESGTKLQLSNLSDEVSNEDIRELFSE 339 ++ PWQ+ + D +A +SGVE GT+L ++NL V+NEDIRELFSE Sbjct: 68 RSLPWQSGLFEDGLRAAGASGVEVGTRLHVTNLDQGVTNEDIRELFSE 115