BLASTX nr result
ID: Lithospermum22_contig00030283
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030283 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302340.1| predicted protein [Populus trichocarpa] gi|2... 129 2e-28 ref|XP_002281307.1| PREDICTED: AP-4 complex subunit mu-1 [Vitis ... 125 4e-27 ref|XP_004154854.1| PREDICTED: AP-4 complex subunit mu-1-like [C... 124 8e-27 ref|XP_004147850.1| PREDICTED: LOW QUALITY PROTEIN: AP-4 complex... 124 8e-27 ref|NP_849437.1| AP-4 complex subunit mu-1 [Arabidopsis thaliana... 119 2e-25 >ref|XP_002302340.1| predicted protein [Populus trichocarpa] gi|222844066|gb|EEE81613.1| predicted protein [Populus trichocarpa] Length = 446 Score = 129 bits (324), Expect = 2e-28 Identities = 58/63 (92%), Positives = 63/63 (100%) Frame = -2 Query: 190 IISQFFVLSQRGDNIVFRDYRGDIPKGSAEIFFRKVKFWKQDGEEEAPPIFNVDGVNYFH 11 +ISQFFVLSQRGDNIVFRDYRG++PKGSAEIFFRKVKFWK+DGEEEAPP+FNVDGVNYFH Sbjct: 1 MISQFFVLSQRGDNIVFRDYRGEVPKGSAEIFFRKVKFWKEDGEEEAPPVFNVDGVNYFH 60 Query: 10 VKV 2 VKV Sbjct: 61 VKV 63 >ref|XP_002281307.1| PREDICTED: AP-4 complex subunit mu-1 [Vitis vinifera] gi|302142544|emb|CBI19747.3| unnamed protein product [Vitis vinifera] Length = 451 Score = 125 bits (314), Expect = 4e-27 Identities = 56/63 (88%), Positives = 62/63 (98%) Frame = -2 Query: 190 IISQFFVLSQRGDNIVFRDYRGDIPKGSAEIFFRKVKFWKQDGEEEAPPIFNVDGVNYFH 11 +ISQFFVLSQRGDNIVFRDYRG++PKGSAEIFFRKVKFWK+DGE +APP+FNVDGVNYFH Sbjct: 1 MISQFFVLSQRGDNIVFRDYRGEVPKGSAEIFFRKVKFWKEDGEGDAPPVFNVDGVNYFH 60 Query: 10 VKV 2 VKV Sbjct: 61 VKV 63 >ref|XP_004154854.1| PREDICTED: AP-4 complex subunit mu-1-like [Cucumis sativus] Length = 451 Score = 124 bits (311), Expect = 8e-27 Identities = 55/63 (87%), Positives = 62/63 (98%) Frame = -2 Query: 190 IISQFFVLSQRGDNIVFRDYRGDIPKGSAEIFFRKVKFWKQDGEEEAPPIFNVDGVNYFH 11 +ISQFFVLSQRGDNIVFRDYRG++PKGSAEIFFRKVKFWK+DGE +APP+FN+DGVNYFH Sbjct: 1 MISQFFVLSQRGDNIVFRDYRGEVPKGSAEIFFRKVKFWKEDGEGDAPPVFNLDGVNYFH 60 Query: 10 VKV 2 VKV Sbjct: 61 VKV 63 >ref|XP_004147850.1| PREDICTED: LOW QUALITY PROTEIN: AP-4 complex subunit mu-1-like [Cucumis sativus] Length = 451 Score = 124 bits (311), Expect = 8e-27 Identities = 55/63 (87%), Positives = 62/63 (98%) Frame = -2 Query: 190 IISQFFVLSQRGDNIVFRDYRGDIPKGSAEIFFRKVKFWKQDGEEEAPPIFNVDGVNYFH 11 +ISQFFVLSQRGDNIVFRDYRG++PKGSAEIFFRKVKFWK+DGE +APP+FN+DGVNYFH Sbjct: 1 MISQFFVLSQRGDNIVFRDYRGEVPKGSAEIFFRKVKFWKEDGEGDAPPVFNLDGVNYFH 60 Query: 10 VKV 2 VKV Sbjct: 61 VKV 63 >ref|NP_849437.1| AP-4 complex subunit mu-1 [Arabidopsis thaliana] gi|332659523|gb|AEE84923.1| AP-4 complex subunit mu-1 [Arabidopsis thaliana] Length = 380 Score = 119 bits (299), Expect = 2e-25 Identities = 54/63 (85%), Positives = 58/63 (92%) Frame = -2 Query: 190 IISQFFVLSQRGDNIVFRDYRGDIPKGSAEIFFRKVKFWKQDGEEEAPPIFNVDGVNYFH 11 +ISQFFVLSQRGDNIVFRDYR ++PKGS E FFRKVKFWK+DG EAPPIFNVDGVNYFH Sbjct: 2 MISQFFVLSQRGDNIVFRDYRAEVPKGSTETFFRKVKFWKEDGNAEAPPIFNVDGVNYFH 61 Query: 10 VKV 2 VKV Sbjct: 62 VKV 64