BLASTX nr result
ID: Lithospermum22_contig00030227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030227 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517914.1| PREDICTED: thioredoxin H7-like [Glycine max] 62 4e-08 ref|XP_003519131.1| PREDICTED: thioredoxin H2-like [Glycine max] 62 5e-08 ref|XP_002324032.1| thioredoxin h [Populus trichocarpa] gi|22286... 62 5e-08 gb|AGG09341.1| thioredoxin h3 [Vitis vinifera] 60 2e-07 ref|XP_003613548.1| Thioredoxin [Medicago truncatula] gi|2693158... 60 2e-07 >ref|XP_003517914.1| PREDICTED: thioredoxin H7-like [Glycine max] Length = 124 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 3 ELMNVAEEFGVRSMPTFVLIKKGTTVDRFVGTKKEGLQYIIEKH 134 ELM V++EF V++MPTF+LIKKG VD+ VG KKE LQ +IEKH Sbjct: 79 ELMEVSQEFKVQAMPTFILIKKGKVVDKVVGAKKEELQKLIEKH 122 >ref|XP_003519131.1| PREDICTED: thioredoxin H2-like [Glycine max] Length = 128 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 3 ELMNVAEEFGVRSMPTFVLIKKGTTVDRFVGTKKEGLQYIIEKH 134 ELM V++EF V +MPTF+LIKKG VD+ VG KKE LQ +IEKH Sbjct: 83 ELMGVSQEFQVHAMPTFILIKKGKVVDKVVGAKKEELQKLIEKH 126 >ref|XP_002324032.1| thioredoxin h [Populus trichocarpa] gi|222867034|gb|EEF04165.1| thioredoxin h [Populus trichocarpa] Length = 131 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = +3 Query: 3 ELMNVAEEFGVRSMPTFVLIKKGTTVDRFVGTKKEGLQYIIEKH 134 EL +VA+EFGV++MPTFVL+KKG VDR VG +KE LQ IEKH Sbjct: 87 ELPDVAQEFGVQAMPTFVLVKKGNEVDRVVGAQKEELQRKIEKH 130 >gb|AGG09341.1| thioredoxin h3 [Vitis vinifera] Length = 121 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +3 Query: 3 ELMNVAEEFGVRSMPTFVLIKKGTTVDRFVGTKKEGLQYIIEKH 134 EL +VA+EFGV+ MPTF+LIK+GT VD+ VG KKE LQ IE H Sbjct: 75 ELSDVAQEFGVQGMPTFLLIKRGTEVDKVVGAKKEELQKKIEAH 118 >ref|XP_003613548.1| Thioredoxin [Medicago truncatula] gi|269315888|gb|ACZ37070.1| thioredoxin h6 [Medicago truncatula] gi|355514883|gb|AES96506.1| Thioredoxin [Medicago truncatula] gi|388507752|gb|AFK41942.1| unknown [Medicago truncatula] Length = 128 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/44 (59%), Positives = 37/44 (84%) Frame = +3 Query: 3 ELMNVAEEFGVRSMPTFVLIKKGTTVDRFVGTKKEGLQYIIEKH 134 ELM++++EF V++MPTF+L+KKG VD+ VG KKE L+ +IEKH Sbjct: 83 ELMSISQEFQVQAMPTFILMKKGKVVDKVVGAKKEELEKLIEKH 126