BLASTX nr result
ID: Lithospermum22_contig00030147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030147 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522078.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002522078.1| conserved hypothetical protein [Ricinus communis] gi|223538677|gb|EEF40278.1| conserved hypothetical protein [Ricinus communis] Length = 448 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/68 (41%), Positives = 43/68 (63%) Frame = +1 Query: 49 MDPCPFVRIVISNLALKLNSSNQEFSKIPSLVNSCYCKIKLNKGILSTHLSAVPLILQET 228 MDPCPFVRI++ NLA+K +S++ S + +SC+CKIKL T + +PL+ Q+ Sbjct: 1 MDPCPFVRILVGNLAIKFPTSSR--SSVSRSTSSCFCKIKLKN--FPTQQATIPLLHQQE 56 Query: 229 SAIESKIN 252 +S+ N Sbjct: 57 PQAQSQEN 64