BLASTX nr result
ID: Lithospermum22_contig00030084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00030084 (626 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516147.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >ref|XP_002516147.1| conserved hypothetical protein [Ricinus communis] gi|223544633|gb|EEF46149.1| conserved hypothetical protein [Ricinus communis] Length = 262 Score = 58.2 bits (139), Expect = 1e-06 Identities = 44/115 (38%), Positives = 59/115 (51%), Gaps = 4/115 (3%) Frame = -2 Query: 625 RKRKNLLAHNIYWNKNNHNRLRASSGGITKRTI-NSRSSVALA-AMGLYEXXXXXXXXXX 452 R+R+NLLA N W+KN R++ GGI+KR I +S+S++ALA AM E Sbjct: 136 RRRRNLLAFNHVWDKNRSFPHRSNGGGISKRPISSSKSTLALAVAMSSSESISSASEDST 195 Query: 451 XXXXXXXXXXXXXXXSRTLSYKEFYAS--PQHQTFSPWRSFSLSDLQGVDAATSS 293 R+ +Y AS Q FSPWRSFS++DLQ AT+S Sbjct: 196 SSSMSNTPTHLPPLHPRSRTYHNNLASLPSPRQNFSPWRSFSVADLQ--QCATTS 248