BLASTX nr result
ID: Lithospermum22_contig00029907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029907 (707 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63187.1| hypothetical protein 20.t00039 [Asparagus officin... 50 1e-07 >gb|ABD63187.1| hypothetical protein 20.t00039 [Asparagus officinalis] Length = 388 Score = 50.1 bits (118), Expect(2) = 1e-07 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = +1 Query: 1 IHQKLPQKLEHPGSLTISCAIGGKNFGKALCDLATNINLMSL 126 I KLP KL+ PGS +I C IG + +ALCDL ++NLM L Sbjct: 103 IQNKLPPKLKDPGSFSIPCTIGDMSINRALCDLGASVNLMPL 144 Score = 32.0 bits (71), Expect(2) = 1e-07 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +3 Query: 120 VVRKLRLGELKSITISLQLADTSI 191 + KL++G+LK TISLQLAD S+ Sbjct: 146 ICNKLQIGDLKPTTISLQLADRSV 169