BLASTX nr result
ID: Lithospermum22_contig00029785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029785 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887198.1| hypothetical protein ARALYDRAFT_315886 [Arab... 55 4e-06 ref|NP_564939.1| uncharacterized protein [Arabidopsis thaliana] ... 55 4e-06 gb|AFK34652.1| unknown [Lotus japonicus] 55 8e-06 >ref|XP_002887198.1| hypothetical protein ARALYDRAFT_315886 [Arabidopsis lyrata subsp. lyrata] gi|297333039|gb|EFH63457.1| hypothetical protein ARALYDRAFT_315886 [Arabidopsis lyrata subsp. lyrata] Length = 75 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 130 KQKKGAPIKFLVPLIYAPVLPLIRLTLRH 216 ++KKGAPIKFLVPLIYAP LPLIRL+LRH Sbjct: 14 RKKKGAPIKFLVPLIYAPALPLIRLSLRH 42 >ref|NP_564939.1| uncharacterized protein [Arabidopsis thaliana] gi|21593844|gb|AAM65811.1| unknown [Arabidopsis thaliana] gi|88010900|gb|ABD38870.1| At1g68680 [Arabidopsis thaliana] gi|332196706|gb|AEE34827.1| uncharacterized protein [Arabidopsis thaliana] Length = 75 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 130 KQKKGAPIKFLVPLIYAPVLPLIRLTLRH 216 ++KKGAPIKFLVPLIYAP LPLIRL+LRH Sbjct: 14 RKKKGAPIKFLVPLIYAPALPLIRLSLRH 42 >gb|AFK34652.1| unknown [Lotus japonicus] Length = 80 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 115 EQLGRKQKKGAPIKFLVPLIYAPVLPLIRLTLRH 216 E + RK+ GAPIKFL+PLIYAPVLPLIR+ LRH Sbjct: 14 EPVVRKKNNGAPIKFLLPLIYAPVLPLIRIALRH 47