BLASTX nr result
ID: Lithospermum22_contig00029539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029539 (440 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ91393.1| predicted protein [Hordeum vulgare subsp. vulgare] 110 1e-22 gb|ACJ54643.1| putative mitochondrial cysteine synthase precurso... 110 1e-22 gb|ACJ54642.1| putative mitochondrial cysteine synthase precurso... 110 1e-22 ref|XP_003568981.1| PREDICTED: cysteine synthase, chloroplastic/... 109 3e-22 ref|XP_003568980.1| PREDICTED: cysteine synthase, chloroplastic/... 109 3e-22 >dbj|BAJ91393.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 389 Score = 110 bits (275), Expect = 1e-22 Identities = 49/90 (54%), Positives = 65/90 (72%) Frame = +1 Query: 169 FGAELHLCDSSKGLEGILQLAQELLDRTPNSFFLKQFDNPANPKVHYETSGPEIWNTCEG 348 FGAEL L D++KG++G L A E+L++TPNS+ L+QFDNPANPKVHYET+GPEIW +G Sbjct: 179 FGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGPEIWEDSKG 238 Query: 349 NIDVFXXXXXXXXXXXXXXKFLKEKNPDIQ 438 +D+F +FLKEKNPD++ Sbjct: 239 KVDIFIGGIGTGGTISGTGRFLKEKNPDVK 268 >gb|ACJ54643.1| putative mitochondrial cysteine synthase precursor [Aegilops speltoides] gi|213958275|gb|ACJ54644.1| putative mitochondrial cysteine synthase precursor [Triticum urartu] gi|213958277|gb|ACJ54645.1| putative mitochondrial cysteine synthase precursor [Triticum monococcum] Length = 214 Score = 110 bits (275), Expect = 1e-22 Identities = 49/90 (54%), Positives = 65/90 (72%) Frame = +1 Query: 169 FGAELHLCDSSKGLEGILQLAQELLDRTPNSFFLKQFDNPANPKVHYETSGPEIWNTCEG 348 FGAEL L D++KG++G L A E+L++TPNS+ L+QFDNPANPKVHYET+GPEIW +G Sbjct: 67 FGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGPEIWEDSKG 126 Query: 349 NIDVFXXXXXXXXXXXXXXKFLKEKNPDIQ 438 +D+F +FLKEKNPD++ Sbjct: 127 KVDIFIGGIGTGGTISGAGRFLKEKNPDVK 156 >gb|ACJ54642.1| putative mitochondrial cysteine synthase precursor [Secale cereale] Length = 175 Score = 110 bits (275), Expect = 1e-22 Identities = 49/90 (54%), Positives = 65/90 (72%) Frame = +1 Query: 169 FGAELHLCDSSKGLEGILQLAQELLDRTPNSFFLKQFDNPANPKVHYETSGPEIWNTCEG 348 FGAEL L D++KG++G L A E+L++TPNS+ L+QFDNPANPKVHYET+GPEIW +G Sbjct: 64 FGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGPEIWEDSKG 123 Query: 349 NIDVFXXXXXXXXXXXXXXKFLKEKNPDIQ 438 +D+F +FLKEKNPD++ Sbjct: 124 KVDIFIGGIGTGGTISGAGRFLKEKNPDVK 153 >ref|XP_003568981.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like isoform 2 [Brachypodium distachyon] Length = 385 Score = 109 bits (272), Expect = 3e-22 Identities = 49/90 (54%), Positives = 65/90 (72%) Frame = +1 Query: 169 FGAELHLCDSSKGLEGILQLAQELLDRTPNSFFLKQFDNPANPKVHYETSGPEIWNTCEG 348 FGAEL L D++KG++G L A E+L++TPNS+ L+QFDNPANPKVHYET+GPEIW +G Sbjct: 181 FGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGPEIWEDSKG 240 Query: 349 NIDVFXXXXXXXXXXXXXXKFLKEKNPDIQ 438 +D+F +FLKEKNP+I+ Sbjct: 241 KVDIFIGGIGTGGTISGSGRFLKEKNPEIK 270 >ref|XP_003568980.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like isoform 1 [Brachypodium distachyon] Length = 391 Score = 109 bits (272), Expect = 3e-22 Identities = 49/90 (54%), Positives = 65/90 (72%) Frame = +1 Query: 169 FGAELHLCDSSKGLEGILQLAQELLDRTPNSFFLKQFDNPANPKVHYETSGPEIWNTCEG 348 FGAEL L D++KG++G L A E+L++TPNS+ L+QFDNPANPKVHYET+GPEIW +G Sbjct: 181 FGAELVLTDAAKGMKGALDKATEILNKTPNSYMLEQFDNPANPKVHYETTGPEIWEDSKG 240 Query: 349 NIDVFXXXXXXXXXXXXXXKFLKEKNPDIQ 438 +D+F +FLKEKNP+I+ Sbjct: 241 KVDIFIGGIGTGGTISGSGRFLKEKNPEIK 270