BLASTX nr result
ID: Lithospermum22_contig00029533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029533 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002439256.1| hypothetical protein SORBIDRAFT_09g003220 [S... 55 6e-06 >ref|XP_002439256.1| hypothetical protein SORBIDRAFT_09g003220 [Sorghum bicolor] gi|241944541|gb|EES17686.1| hypothetical protein SORBIDRAFT_09g003220 [Sorghum bicolor] Length = 588 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/33 (78%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = -2 Query: 239 YISGSPVMFVGCGQSYTDL--MNVNTIVNTLLK 147 Y+SG+PVMFVGCGQSYTDL +NV +IVNTLLK Sbjct: 556 YVSGAPVMFVGCGQSYTDLKKLNVKSIVNTLLK 588