BLASTX nr result
ID: Lithospermum22_contig00029523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029523 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67299.1| hypothetical protein VITISV_002040 [Vitis vinifera] 55 8e-06 >emb|CAN67299.1| hypothetical protein VITISV_002040 [Vitis vinifera] Length = 122 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -3 Query: 96 SSIVYIEGNLETKIFNDSITGLVRRVREISIR 1 SS++Y+EGNLETKIF D +TGLVRR+RE++IR Sbjct: 79 SSVLYLEGNLETKIFTDPVTGLVRRIREVAIR 110