BLASTX nr result
ID: Lithospermum22_contig00029305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029305 (487 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002338323.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002325562.1| predicted protein [Populus trichocarpa] gi|2... 72 4e-11 ref|XP_002327331.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_004150400.1| PREDICTED: uncharacterized protein LOC101215... 69 4e-10 ref|XP_002526843.1| tetratricopeptide repeat protein, tpr, putat... 68 9e-10 >ref|XP_002338323.1| predicted protein [Populus trichocarpa] gi|222871911|gb|EEF09042.1| predicted protein [Populus trichocarpa] Length = 69 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 486 LKAFEEVLLFDPNNKIARPRRDALKDKVTLYRDVPVNTKKR 364 LKAFEEVLLFDPNNK+ARPRRDALKDKV +YR VP+ +K R Sbjct: 29 LKAFEEVLLFDPNNKVARPRRDALKDKVQMYRGVPIKSKDR 69 >ref|XP_002325562.1| predicted protein [Populus trichocarpa] gi|222862437|gb|EEE99943.1| predicted protein [Populus trichocarpa] Length = 221 Score = 72.4 bits (176), Expect = 4e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = -2 Query: 486 LKAFEEVLLFDPNNKIARPRRDALKDKVTLYRDVPVNTKKR 364 LKAFEEVLLFDPNNK+ARPRRDALKDKV +YR VP+ +K R Sbjct: 181 LKAFEEVLLFDPNNKVARPRRDALKDKVQMYRGVPIKSKDR 221 >ref|XP_002327331.1| predicted protein [Populus trichocarpa] gi|222835701|gb|EEE74136.1| predicted protein [Populus trichocarpa] Length = 225 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -2 Query: 486 LKAFEEVLLFDPNNKIARPRRDALKDKVTLYRDVPVNTKKR 364 LKAFEEVLLFDPNNK+ARPRRDALKDKV +Y+ VP+ +K R Sbjct: 185 LKAFEEVLLFDPNNKVARPRRDALKDKVQMYKGVPIKSKDR 225 >ref|XP_004150400.1| PREDICTED: uncharacterized protein LOC101215394 [Cucumis sativus] gi|449496895|ref|XP_004160255.1| PREDICTED: uncharacterized LOC101215394 [Cucumis sativus] Length = 313 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -2 Query: 486 LKAFEEVLLFDPNNKIARPRRDALKDKVTLYRDVPVNTKKR 364 LKAFEEVLLFDPNNK+ARPRRDALK++V +Y+ VPV +K R Sbjct: 273 LKAFEEVLLFDPNNKLARPRRDALKERVDMYKGVPVKSKNR 313 >ref|XP_002526843.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] gi|223533847|gb|EEF35578.1| tetratricopeptide repeat protein, tpr, putative [Ricinus communis] Length = 258 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -2 Query: 486 LKAFEEVLLFDPNNKIARPRRDALKDKVTLYRDVPVNTKK 367 LKAFEEVLLFDPNNK+ARPRRDA+KD+V +Y+ +PV + K Sbjct: 217 LKAFEEVLLFDPNNKVARPRRDAMKDRVQMYKGIPVKSNK 256