BLASTX nr result
ID: Lithospermum22_contig00029302
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029302 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD16139.1| DNA-binding protein 2 [Nicotiana tabacum] 66 3e-09 gb|ABA56495.2| transcription factor WRKY2 [Capsicum annuum] 66 3e-09 gb|AEO31474.1| WRKY transcription factor 2-1 [Dimocarpus longan] 57 1e-06 ref|XP_002512134.1| WRKY transcription factor, putative [Ricinus... 55 5e-06 >gb|AAD16139.1| DNA-binding protein 2 [Nicotiana tabacum] Length = 528 Score = 65.9 bits (159), Expect = 3e-09 Identities = 38/92 (41%), Positives = 55/92 (59%), Gaps = 7/92 (7%) Frame = -1 Query: 257 YGMSHQQVLSQITSQAVQMQTQNRMNSAYTTFSAPQPPPQSYVQ-------ATRQQPQPF 99 +GMSHQQ L+Q+T+QA Q+Q + Y + SA P S Q A +Q P P Sbjct: 145 FGMSHQQALAQVTAQAAHPQSQMHIQPDYPSSSAAPAPSFSQFQSLTSNATANKQIPPPA 204 Query: 98 SAPNGNNILQDSRDGSLADQRSQPSSFNVDKP 3 S P N+++++ + SL+DQRS+P+S VDKP Sbjct: 205 SDP---NVMKEASEVSLSDQRSEPASSAVDKP 233 >gb|ABA56495.2| transcription factor WRKY2 [Capsicum annuum] Length = 490 Score = 65.9 bits (159), Expect = 3e-09 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 6/91 (6%) Frame = -1 Query: 257 YGMSHQQVLSQITSQAVQMQTQNRMNSAYTTFSAPQPPPQSYVQ------ATRQQPQPFS 96 +GMSHQQVL+Q+T+QA Q Q+Q + Y++ SA S Q A QQ P Sbjct: 121 FGMSHQQVLAQLTAQASQPQSQMHIQPDYSSSSAATALSMSPFQSLTSNTAANQQIPPAL 180 Query: 95 APNGNNILQDSRDGSLADQRSQPSSFNVDKP 3 P N +++S D SL+DQRS+P+SF VDKP Sbjct: 181 DP---NTIKESSDVSLSDQRSEPASFVVDKP 208 >gb|AEO31474.1| WRKY transcription factor 2-1 [Dimocarpus longan] Length = 297 Score = 57.4 bits (137), Expect = 1e-06 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 4/89 (4%) Frame = -1 Query: 257 YGMSHQQVLSQITSQAVQMQTQNRMNSAYTTFSAPQPPPQSYVQ----ATRQQPQPFSAP 90 +GM+HQQ L+Q+T+QA Q Q+ ++ + + + S P S Q T QQ P S Sbjct: 160 FGMTHQQALAQVTAQAAQAQSHIQIQADHVS-SFSSAPGTSMAQMSSFTTTQQQMPPSVT 218 Query: 89 NGNNILQDSRDGSLADQRSQPSSFNVDKP 3 + ++++ D S ++QR QPSS+ VDKP Sbjct: 219 DSRLAMKENSDFSHSNQRLQPSSYTVDKP 247 >ref|XP_002512134.1| WRKY transcription factor, putative [Ricinus communis] gi|223549314|gb|EEF50803.1| WRKY transcription factor, putative [Ricinus communis] Length = 468 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 2/87 (2%) Frame = -1 Query: 257 YGMSHQQVLSQITSQAVQMQTQNRMNSAYTTFSAPQPPPQSYVQ--ATRQQPQPFSAPNG 84 +GM+HQQ L+Q+T+QA + + + + Y++ A S + +T Q P S P+ Sbjct: 96 FGMTHQQALAQVTAQAAEANSHIHIQAQYSSAPATSSTQFSSISTNSTIHQQMPSSIPDT 155 Query: 83 NNILQDSRDGSLADQRSQPSSFNVDKP 3 N ++ D S DQR+Q SS VDKP Sbjct: 156 NASEKELSDFSFPDQRAQASSVTVDKP 182