BLASTX nr result
ID: Lithospermum22_contig00029149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00029149 (253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulga... 47 8e-06 >emb|CCA66050.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1357 Score = 47.4 bits (111), Expect(2) = 8e-06 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +3 Query: 33 IWSLKTHPRVKTFIWLTCLDKLPTKSSLFKKHLIPDHLCSSCFSEELSAFSL 188 +WSL P+V+ F+W C LP + L ++HLI + C C E+ + F L Sbjct: 1042 LWSLNVSPKVRHFLWRACTSSLPVRKVLQRRHLIDEAGCPCCAREDETQFHL 1093 Score = 26.9 bits (58), Expect(2) = 8e-06 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 178 HFLWECPRSLLFWKELG 228 H + CP SL W+ELG Sbjct: 1092 HLFYRCPMSLKLWEELG 1108