BLASTX nr result
ID: Lithospermum22_contig00028483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028483 (335 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519191.1| pentatricopeptide repeat-containing protein,... 64 1e-08 ref|XP_004162218.1| PREDICTED: putative pentatricopeptide repeat... 61 1e-07 ref|XP_004134500.1| PREDICTED: LOW QUALITY PROTEIN: putative pen... 61 1e-07 >ref|XP_002519191.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541506|gb|EEF43055.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 719 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/65 (50%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +3 Query: 144 LNPSTGNKNPI-LKFNSISTNYNHQSNVNPLDHHYFRRVLANKDWFLLLNHEIKAKRLVL 320 LNP N N + + N IS N + P+DHHYF R+L+ DWFLLLNHE KAKR+ L Sbjct: 56 LNPQFTNPNSLKISNNPISANKYSK----PIDHHYFSRILSRHDWFLLLNHEFKAKRITL 111 Query: 321 NPQCV 335 N V Sbjct: 112 NSHSV 116 >ref|XP_004162218.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Cucumis sativus] Length = 697 Score = 60.8 bits (146), Expect = 1e-07 Identities = 40/103 (38%), Positives = 58/103 (56%), Gaps = 14/103 (13%) Frame = +3 Query: 69 YFPQSQPSQTPPKVNSLTSFGQNPSLN---PSTGNKNPI---LKFNS---IST-----NY 206 Y P ++ + P + + Q+P N PS GN +P+ LK S +ST + Sbjct: 23 YTPINKHRRQLPSNSIQRTSKQSPFNNLEAPSRGNPSPLTTPLKAPSSIQLSTPPSLADD 82 Query: 207 NHQSNVNPLDHHYFRRVLANKDWFLLLNHEIKAKRLVLNPQCV 335 H ++ P+D Y ++L +KDWFLLLNHE KAKR+VL+PQ V Sbjct: 83 KHSLSLKPIDRSYISKILLSKDWFLLLNHEFKAKRVVLSPQFV 125 >ref|XP_004134500.1| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing protein At3g16890, mitochondrial-like [Cucumis sativus] Length = 688 Score = 60.8 bits (146), Expect = 1e-07 Identities = 40/103 (38%), Positives = 58/103 (56%), Gaps = 14/103 (13%) Frame = +3 Query: 69 YFPQSQPSQTPPKVNSLTSFGQNPSLN---PSTGNKNPI---LKFNS---IST-----NY 206 Y P ++ + P + + Q+P N PS GN +P+ LK S +ST + Sbjct: 23 YTPINKHRRQLPSNSIQRTSKQSPFNNLEAPSRGNPSPLTTPLKAPSSIQLSTPPSLADD 82 Query: 207 NHQSNVNPLDHHYFRRVLANKDWFLLLNHEIKAKRLVLNPQCV 335 H ++ P+D Y ++L +KDWFLLLNHE KAKR+VL+PQ V Sbjct: 83 KHSLSLKPIDRSYISKILLSKDWFLLLNHEFKAKRVVLSPQFV 125