BLASTX nr result
ID: Lithospermum22_contig00028377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028377 (397 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273844.1| PREDICTED: UPF0187 protein At3g61320, chloro... 94 2e-17 ref|XP_002511848.1| conserved hypothetical protein [Ricinus comm... 82 4e-14 ref|XP_002320128.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 ref|NP_191691.2| Bestrophin-like protein [Arabidopsis thaliana] ... 75 4e-12 emb|CAB71062.1| putative protein [Arabidopsis thaliana] 75 4e-12 >ref|XP_002273844.1| PREDICTED: UPF0187 protein At3g61320, chloroplastic [Vitis vinifera] Length = 419 Score = 93.6 bits (231), Expect = 2e-17 Identities = 50/105 (47%), Positives = 62/105 (59%) Frame = +1 Query: 82 MENSTRLIQPPTDXXXXXXXXXXXXXXRFHNPSFACKNVKLTFRVNSSSHPSQSHRPAST 261 M T IQ PT+ FH K KL+FRV SS P+ST Sbjct: 1 MRKPTHSIQLPTNLAPYSSLKTIP---NFHFLPLPSKPTKLSFRVFSSRSADSPPPPSST 57 Query: 262 KQSTLVSLLRALPDWADRIKERGVKKKRTLYNHETWVQHRSSLRH 396 + TL+S+LR +PDWAD IKERG+++KR+LYNHETWV+HRSS RH Sbjct: 58 QNLTLISILRTVPDWADAIKERGMQQKRSLYNHETWVEHRSSRRH 102 >ref|XP_002511848.1| conserved hypothetical protein [Ricinus communis] gi|223549028|gb|EEF50517.1| conserved hypothetical protein [Ricinus communis] Length = 417 Score = 82.4 bits (202), Expect = 4e-14 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = +1 Query: 190 KNVKLTFRVNSSSHPSQSHRPASTKQSTLVSLLRALPDWADRIKERGVKKKRTLYNHETW 369 K L+ + S P H+ T TL+SLLRA+PDW+DRIKERG+++KRTLYNH W Sbjct: 42 KKSNLSLKTLCSKPPPNPHK---TLTLTLISLLRAIPDWSDRIKERGMQQKRTLYNHNKW 98 Query: 370 VQHRSSLRH 396 V+HRSSLRH Sbjct: 99 VEHRSSLRH 107 >ref|XP_002320128.1| predicted protein [Populus trichocarpa] gi|222860901|gb|EEE98443.1| predicted protein [Populus trichocarpa] Length = 348 Score = 76.6 bits (187), Expect = 2e-12 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = +1 Query: 274 LVSLLRALPDWADRIKERGVKKKRTLYNHETWVQHRSSLRH 396 + SLLRA+PDWADR+KERG++KKR+LYNHE WV+HRSS RH Sbjct: 1 ITSLLRAIPDWADRVKERGMRKKRSLYNHEKWVEHRSSFRH 41 >ref|NP_191691.2| Bestrophin-like protein [Arabidopsis thaliana] gi|20141056|sp|Q9M2D2.2|YU88_ARATH RecName: Full=UPF0187 protein At3g61320, chloroplastic; Flags: Precursor gi|16604549|gb|AAL24280.1| AT3g61320/T20K12_220 [Arabidopsis thaliana] gi|23296291|gb|AAN12915.1| At3g61320/T20K12_220 [Arabidopsis thaliana] gi|332646666|gb|AEE80187.1| Bestrophin-like protein [Arabidopsis thaliana] Length = 410 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = +1 Query: 223 SSHPSQSHRPASTKQSTLVSLLRALPDWADRIKERGVKKKRTLYNHETWVQHRSSLRH 396 SS P + T L+ LLRA+PDWAD IKERG+++KR+LY HE WV+HRSSLRH Sbjct: 42 SSGPESNDSGHETLTDKLIHLLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRH 99 >emb|CAB71062.1| putative protein [Arabidopsis thaliana] Length = 406 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/58 (58%), Positives = 42/58 (72%) Frame = +1 Query: 223 SSHPSQSHRPASTKQSTLVSLLRALPDWADRIKERGVKKKRTLYNHETWVQHRSSLRH 396 SS P + T L+ LLRA+PDWAD IKERG+++KR+LY HE WV+HRSSLRH Sbjct: 38 SSGPESNDSGHETLTDKLIHLLRAVPDWADEIKERGMQQKRSLYTHEKWVEHRSSLRH 95