BLASTX nr result
ID: Lithospermum22_contig00028364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028364 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278276.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 emb|CAN77580.1| hypothetical protein VITISV_015346 [Vitis vinifera] 57 2e-06 >ref|XP_002278276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38150-like [Vitis vinifera] Length = 307 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 2 EGAEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 130 EG E LE +K+KG P+E VREILK +RG+V+R IM IL+GK Sbjct: 265 EGREFLEQMKAKGFTPDEKAVREILKNRRGQVFRSIMDILFGK 307 >emb|CAN77580.1| hypothetical protein VITISV_015346 [Vitis vinifera] Length = 347 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +2 Query: 2 EGAEVLEMVKSKGVVPEEDMVREILKGKRGKVYRDIMSILYGK 130 EG E LE +K+KG P+E VREILK +RG+V+R IM IL+GK Sbjct: 305 EGREFLEQMKAKGFTPDEKAVREILKNRRGQVFRSIMDILFGK 347