BLASTX nr result
ID: Lithospermum22_contig00028346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028346 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888671.1| hypothetical protein ARALYDRAFT_475977 [Arab... 55 6e-06 >ref|XP_002888671.1| hypothetical protein ARALYDRAFT_475977 [Arabidopsis lyrata subsp. lyrata] gi|297334512|gb|EFH64930.1| hypothetical protein ARALYDRAFT_475977 [Arabidopsis lyrata subsp. lyrata] Length = 327 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/61 (44%), Positives = 37/61 (60%) Frame = -1 Query: 183 RSSGKARISKGEKNCDMLEKKMVGVNKQKNGKYNARMKHPISKKGIWLGTFDSAEEAAMV 4 ++ K +S +L KK VGV ++K GK+ A ++HPI K WLGTFD+ EEAA Sbjct: 96 KTVSKKAVSASPACPGLLTKKPVGVRQRKWGKWAAEIRHPIKKTRTWLGTFDTLEEAAKA 155 Query: 3 Y 1 Y Sbjct: 156 Y 156