BLASTX nr result
ID: Lithospermum22_contig00028294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028294 (415 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533372.1| cysteinyl-tRNA synthetase, putative [Ricinus... 71 1e-10 ref|XP_003592632.1| Cysteinyl-tRNA synthetase [Medicago truncatu... 69 5e-10 ref|XP_002262997.2| PREDICTED: cysteinyl-tRNA synthetase-like [V... 66 3e-09 ref|XP_003631732.1| PREDICTED: cysteinyl-tRNA synthetase-like [V... 65 6e-09 ref|NP_198699.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana... 62 4e-08 >ref|XP_002533372.1| cysteinyl-tRNA synthetase, putative [Ricinus communis] gi|223526794|gb|EEF29017.1| cysteinyl-tRNA synthetase, putative [Ricinus communis] Length = 530 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/43 (74%), Positives = 41/43 (95%) Frame = -3 Query: 413 LKTIEEREQARKNKDYARSDQLRSDLEAKGIALMDVGKDTVWR 285 L++IEER QARKNK+++RSDQ+R++L AKGIALMDVGK+TVWR Sbjct: 462 LRSIEERAQARKNKEFSRSDQVRANLAAKGIALMDVGKETVWR 504 >ref|XP_003592632.1| Cysteinyl-tRNA synthetase [Medicago truncatula] gi|355481680|gb|AES62883.1| Cysteinyl-tRNA synthetase [Medicago truncatula] Length = 552 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -3 Query: 413 LKTIEEREQARKNKDYARSDQLRSDLEAKGIALMDVGKDTVWR 285 LK+IEER QAR NKD+A+SD +R+DL AKGIALMDVG +T+WR Sbjct: 468 LKSIEERRQARINKDFAKSDNVRTDLTAKGIALMDVGNETIWR 510 >ref|XP_002262997.2| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] gi|297735988|emb|CBI23962.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -3 Query: 413 LKTIEEREQARKNKDYARSDQLRSDLEAKGIALMDVGKDTVWR 285 L IEER ARKNKD+++ DQ+R+DL +KGIALMDVGK+T+WR Sbjct: 455 LHLIEERALARKNKDFSKGDQIRADLASKGIALMDVGKETIWR 497 >ref|XP_003631732.1| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] gi|296087508|emb|CBI34097.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/43 (67%), Positives = 37/43 (86%) Frame = -3 Query: 413 LKTIEEREQARKNKDYARSDQLRSDLEAKGIALMDVGKDTVWR 285 L IEER ARKNK+++R DQ+R+DL +KGIALMDVGK+T+WR Sbjct: 455 LHLIEERALARKNKNFSRGDQIRADLASKGIALMDVGKETIWR 497 >ref|NP_198699.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] gi|192807340|gb|ACF06122.1| At5g38830 [Arabidopsis thaliana] gi|332006981|gb|AED94364.1| cysteinyl-tRNA synthetase [Arabidopsis thaliana] Length = 511 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -3 Query: 404 IEEREQARKNKDYARSDQLRSDLEAKGIALMDVGKDTVWR 285 IEER ARKNKD+A+SD++R L KGIALMD+GK+TVWR Sbjct: 461 IEERITARKNKDFAKSDEIREKLTRKGIALMDIGKETVWR 500