BLASTX nr result
ID: Lithospermum22_contig00028233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028233 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519272.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 gb|AFK41301.1| unknown [Medicago truncatula] 55 6e-06 ref|XP_003533129.1| PREDICTED: F-box protein At5g49610-like [Gly... 55 6e-06 gb|ACU20187.1| unknown [Glycine max] 55 6e-06 ref|XP_003594683.1| F-box protein [Medicago truncatula] gi|21707... 55 6e-06 >ref|XP_002519272.1| conserved hypothetical protein [Ricinus communis] gi|223541587|gb|EEF43136.1| conserved hypothetical protein [Ricinus communis] Length = 325 Score = 58.2 bits (139), Expect = 7e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 368 KVWKEIYSIKNSSTLPLWFSTHSFRSTLNSC 276 +VWKE+YS KNSSTLPLWFS H+FRST+ SC Sbjct: 294 RVWKEMYSAKNSSTLPLWFSAHAFRSTIFSC 324 >gb|AFK41301.1| unknown [Medicago truncatula] Length = 249 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 368 KVWKEIYSIKNSSTLPLWFSTHSFRSTLNSC 276 +VWKE+YS+K SSTLPLWFS H++RST+ SC Sbjct: 218 QVWKEMYSVKYSSTLPLWFSAHAYRSTMFSC 248 >ref|XP_003533129.1| PREDICTED: F-box protein At5g49610-like [Glycine max] Length = 372 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 368 KVWKEIYSIKNSSTLPLWFSTHSFRSTLNSC 276 +VWKE+YS+K SSTLPLWFS H++RST+ SC Sbjct: 341 QVWKEMYSVKYSSTLPLWFSAHAYRSTMFSC 371 >gb|ACU20187.1| unknown [Glycine max] Length = 219 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 368 KVWKEIYSIKNSSTLPLWFSTHSFRSTLNSC 276 +VWKE+YS+K SSTLPLWFS H++RST+ SC Sbjct: 188 QVWKEMYSVKYSSTLPLWFSAHAYRSTMFSC 218 >ref|XP_003594683.1| F-box protein [Medicago truncatula] gi|217074110|gb|ACJ85415.1| unknown [Medicago truncatula] gi|355483731|gb|AES64934.1| F-box protein [Medicago truncatula] Length = 361 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 368 KVWKEIYSIKNSSTLPLWFSTHSFRSTLNSC 276 +VWKE+YS+K SSTLPLWFS H++RST+ SC Sbjct: 330 QVWKEMYSVKYSSTLPLWFSAHAYRSTMFSC 360