BLASTX nr result
ID: Lithospermum22_contig00028216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028216 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] 58 1e-06 >gb|AFW62558.1| hypothetical protein ZEAMMB73_716887 [Zea mays] Length = 53 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 2 DQTDYYQYDLNCFKDPTCTFLHWALSLTDRIIS 100 DQTDYY+ D NCFKDPTC FLHWALS T+ IS Sbjct: 21 DQTDYYRNDSNCFKDPTCIFLHWALSSTNVKIS 53