BLASTX nr result
ID: Lithospermum22_contig00028121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028121 (499 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522285.1| Cyclic phosphodiesterase, putative [Ricinus ... 56 3e-06 >ref|XP_002522285.1| Cyclic phosphodiesterase, putative [Ricinus communis] gi|223538538|gb|EEF40143.1| Cyclic phosphodiesterase, putative [Ricinus communis] Length = 190 Score = 55.8 bits (133), Expect = 3e-06 Identities = 31/48 (64%), Positives = 34/48 (70%), Gaps = 4/48 (8%) Frame = +2 Query: 5 YRPHLGLLY----TDEKKLAQERVYALDESICSLSFKISRLALYTTDT 136 Y PHL LLY DEKK AQE+ LDESI LSF+ISRLAL+ TDT Sbjct: 124 YMPHLSLLYGDLTDDEKKKAQEKTNILDESINGLSFQISRLALWKTDT 171