BLASTX nr result
ID: Lithospermum22_contig00028048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00028048 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA20532.1| unnamed protein product [Daucus carota] 55 6e-06 >dbj|BAA20532.1| unnamed protein product [Daucus carota] Length = 520 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/85 (32%), Positives = 45/85 (52%), Gaps = 10/85 (11%) Frame = +1 Query: 1 IRCPCRRCQNTLLHSRIDVEFHLISNGFVHDYYTWVYHCENIVEHVHDEQVGTSY----- 165 I+CPC +C+N + V+ HL+ NGFV DYY W H E+ + + +++Q +Y Sbjct: 45 IQCPCTKCKNRKFWNSDIVKLHLLKNGFVRDYYIWSRHGESYIFNGNEDQSSANYSNVAR 104 Query: 166 --DP*NDVYD---QQAGTSYDPQNN 225 D N +Y+ G S+DP + Sbjct: 105 GTDGNNLMYNMVIDAGGPSFDPHRS 129