BLASTX nr result
ID: Lithospermum22_contig00027982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00027982 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610508.1| hypothetical protein MTR_4g132970 [Medicago ... 84 2e-14 ref|XP_003610505.1| hypothetical protein MTR_4g132940 [Medicago ... 84 2e-14 ref|XP_002317198.1| predicted protein [Populus trichocarpa] gi|2... 81 1e-13 ref|XP_003534730.1| PREDICTED: uncharacterized protein LOC100811... 78 9e-13 ref|XP_003594199.1| hypothetical protein MTR_2g025520 [Medicago ... 77 1e-12 >ref|XP_003610508.1| hypothetical protein MTR_4g132970 [Medicago truncatula] gi|355511563|gb|AES92705.1| hypothetical protein MTR_4g132970 [Medicago truncatula] Length = 305 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/55 (63%), Positives = 47/55 (85%) Frame = -2 Query: 302 IFVGEIRKLKKIVRLMCNSIKLSMKTEDIPVPPWRRYAYMQAKWLGPYRRTTNEV 138 +FVG++ +LK++VR+MC++IK SMKT D+ VPPWRR +YMQAKW Y+RTTNEV Sbjct: 210 VFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAKWFNTYKRTTNEV 264 >ref|XP_003610505.1| hypothetical protein MTR_4g132940 [Medicago truncatula] gi|355511560|gb|AES92702.1| hypothetical protein MTR_4g132940 [Medicago truncatula] Length = 287 Score = 83.6 bits (205), Expect = 2e-14 Identities = 35/55 (63%), Positives = 47/55 (85%) Frame = -2 Query: 302 IFVGEIRKLKKIVRLMCNSIKLSMKTEDIPVPPWRRYAYMQAKWLGPYRRTTNEV 138 +FVG++ +LK++VR+MC++IK SMKT D+ VPPWRR +YMQAKW Y+RTTNEV Sbjct: 192 VFVGKVEELKRVVRIMCSAIKDSMKTMDMHVPPWRRNSYMQAKWFNTYKRTTNEV 246 >ref|XP_002317198.1| predicted protein [Populus trichocarpa] gi|222860263|gb|EEE97810.1| predicted protein [Populus trichocarpa] Length = 335 Score = 80.9 bits (198), Expect = 1e-13 Identities = 33/56 (58%), Positives = 46/56 (82%) Frame = -2 Query: 302 IFVGEIRKLKKIVRLMCNSIKLSMKTEDIPVPPWRRYAYMQAKWLGPYRRTTNEVP 135 +++G+ ++K+IVRLMCN+++ SMK +PV PWRRY YM+AKW G Y+RTTNEVP Sbjct: 223 VYIGKPEEVKQIVRLMCNAMRESMKGVGMPVAPWRRYGYMEAKWFGHYKRTTNEVP 278 >ref|XP_003534730.1| PREDICTED: uncharacterized protein LOC100811764 [Glycine max] Length = 281 Score = 77.8 bits (190), Expect = 9e-13 Identities = 33/55 (60%), Positives = 43/55 (78%) Frame = -2 Query: 302 IFVGEIRKLKKIVRLMCNSIKLSMKTEDIPVPPWRRYAYMQAKWLGPYRRTTNEV 138 IFVG++ ++K++VRLMC +IK SMK + +PPWRR YMQAKW G Y+RTTN V Sbjct: 168 IFVGKVEEMKQVVRLMCTAIKGSMKRMKLHIPPWRRNVYMQAKWFGAYKRTTNAV 222 >ref|XP_003594199.1| hypothetical protein MTR_2g025520 [Medicago truncatula] gi|124359329|gb|ABN05810.1| Protein of unknown function DUF506, plant [Medicago truncatula] gi|355483247|gb|AES64450.1| hypothetical protein MTR_2g025520 [Medicago truncatula] Length = 321 Score = 77.4 bits (189), Expect = 1e-12 Identities = 34/55 (61%), Positives = 43/55 (78%) Frame = -2 Query: 302 IFVGEIRKLKKIVRLMCNSIKLSMKTEDIPVPPWRRYAYMQAKWLGPYRRTTNEV 138 IFVG++ +LK+IVRLMC++IK SMK D+ +PPWRR YMQ KW Y+RTTN V Sbjct: 208 IFVGKMEELKRIVRLMCSAIKGSMKKMDLHIPPWRRNLYMQTKWFSSYKRTTNAV 262