BLASTX nr result
ID: Lithospermum22_contig00027966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00027966 (639 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526119.1| ubiquitin-protein ligase, putative [Ricinus ... 57 4e-06 >ref|XP_002526119.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223534616|gb|EEF36313.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 414 Score = 56.6 bits (135), Expect = 4e-06 Identities = 37/124 (29%), Positives = 59/124 (47%) Frame = -3 Query: 451 ILPNIPVDILIELFSSLPIETLVRCRSVCKLWCNILDDLKFIYDHLEKGPFEFTHLALCK 272 +L +P ++L E+ + LP++ L+R RS+ K WC +DD FI HL+K + Sbjct: 1 MLEKLPPELLTEILTRLPVDCLLRFRSISKSWCAKIDDPNFIKTHLKKS----------R 50 Query: 271 DETQETNLIKLRKRRNRFYNFYLLKVDNSFGILDKVWKKSENPTNIMMKSKSFIVGCSKG 92 + LI + FYN L +S + K+ + PT+ K IVG G Sbjct: 51 ETNSNLTLIFAGSHPDYFYNVNL----DSLNSIIKLENPIKGPTDASHNIK--IVGSCNG 104 Query: 91 VVCF 80 ++CF Sbjct: 105 LLCF 108