BLASTX nr result
ID: Lithospermum22_contig00027751
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00027751 (202 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528032.1| pentatricopeptide repeat-containing protein,... 82 3e-14 ref|XP_002890536.1| pentatricopeptide repeat-containing protein ... 81 1e-13 emb|CBI31329.3| unnamed protein product [Vitis vinifera] 81 1e-13 ref|XP_002275945.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 emb|CAN80898.1| hypothetical protein VITISV_028645 [Vitis vinifera] 81 1e-13 >ref|XP_002528032.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223532562|gb|EEF34350.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 730 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/57 (68%), Positives = 45/57 (78%) Frame = -3 Query: 176 ITMASNIFHPLP*NLLIYAYVKNDHYEEAVSVYSYMVNKGVRPDKFTYPSVLKACGE 6 IT SNI HPLP NLLI +YV+N + EA+S Y M +KG+RPDKFTYPSVLKACGE Sbjct: 150 ITENSNILHPLPWNLLISSYVRNGLHGEALSAYKQMTHKGIRPDKFTYPSVLKACGE 206 >ref|XP_002890536.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336378|gb|EFH66795.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 687 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/58 (63%), Positives = 48/58 (82%) Frame = -3 Query: 176 ITMASNIFHPLP*NLLIYAYVKNDHYEEAVSVYSYMVNKGVRPDKFTYPSVLKACGEL 3 IT S+I HPLP N+LI +YV+N +EE+VSVY M++KG++PD+FTYPSVLKACG L Sbjct: 139 ITENSDILHPLPWNVLIDSYVRNKRFEESVSVYKRMMSKGIQPDEFTYPSVLKACGAL 196 >emb|CBI31329.3| unnamed protein product [Vitis vinifera] Length = 753 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = -3 Query: 179 VITMASNIFHPLP*NLLIYAYVKNDHYEEAVSVYSYMVNKGVRPDKFTYPSVLKACGE 6 VIT SNI HP P NLLI +YV+N ++A+S Y MV KG+RPD FTYPSVLKACGE Sbjct: 156 VITENSNILHPFPWNLLISSYVRNGFCQKALSAYKQMVKKGIRPDNFTYPSVLKACGE 213 >ref|XP_002275945.1| PREDICTED: pentatricopeptide repeat-containing protein At1g71490-like [Vitis vinifera] Length = 748 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = -3 Query: 179 VITMASNIFHPLP*NLLIYAYVKNDHYEEAVSVYSYMVNKGVRPDKFTYPSVLKACGE 6 VIT SNI HP P NLLI +YV+N ++A+S Y MV KG+RPD FTYPSVLKACGE Sbjct: 156 VITENSNILHPFPWNLLISSYVRNGFCQKALSAYKQMVKKGIRPDNFTYPSVLKACGE 213 >emb|CAN80898.1| hypothetical protein VITISV_028645 [Vitis vinifera] Length = 822 Score = 80.9 bits (198), Expect = 1e-13 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = -3 Query: 179 VITMASNIFHPLP*NLLIYAYVKNDHYEEAVSVYSYMVNKGVRPDKFTYPSVLKACGE 6 VIT SNI HP P NLLI +YV+N ++A+S Y MV KG+RPD FTYPSVLKACGE Sbjct: 230 VITENSNILHPFPWNLLISSYVRNGFCQKALSAYKQMVKKGIRPDNFTYPSVLKACGE 287