BLASTX nr result
ID: Lithospermum22_contig00027625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00027625 (630 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEK71546.1| hypothetical chloroplast RF2 [Picramnia pentandra] 57 4e-06 >gb|AEK71546.1| hypothetical chloroplast RF2 [Picramnia pentandra] Length = 2269 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 141 RICNQLLESIGLQIVHLNKWKPFLLDGKFTQIK 239 ++CNQLLESIGLQIVHL KWKPFLLD +T K Sbjct: 905 QLCNQLLESIGLQIVHLKKWKPFLLDDHYTSQK 937